KEGG   Synechocystis sp. PCC 6803: sll1342Help
Entry
sll1342           CDS       T00004                                 

Gene name
gap2
Definition
(GenBank) glyceraldehyde-3-phosphate dehydrogenase (NADP+) (phosphorylating)
  KO
K00150  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)) [EC:1.2.1.59]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00010  Glycolysis / Gluconeogenesis
syn00710  Carbon fixation in photosynthetic organisms
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01120  Microbial metabolism in diverse environments
syn01130  Biosynthesis of antibiotics
syn01200  Carbon metabolism
syn01230  Biosynthesis of amino acids
Module
syn_M00002  Glycolysis, core module involving three-carbon compounds
syn_M00165  Reductive pentose phosphate cycle (Calvin cycle)
syn_M00166  Reductive pentose phosphate cycle, ribulose-5P => glyceraldehyde-3P
syn_M00611  Oxygenic photosynthesis in plants and cyanobacteria
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    sll1342 (gap2)
  Energy metabolism
   00710 Carbon fixation in photosynthetic organisms
    sll1342 (gap2)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.2  Acting on the aldehyde or oxo group of donors
   1.2.1  With NAD+ or NADP+ as acceptor
    1.2.1.59  glyceraldehyde-3-phosphate dehydrogenase (NAD(P)+) (phosphorylating)
     sll1342 (gap2)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Gp_dh_C Gp_dh_N NAD_binding_3 GFO_IDH_MocA
Motif
Other DBs
NCBI-ProteinID: BAA18633
CyanoBase: sll1342
CYORF: sll1342
UniProt: P80505
Position
complement(3278122..3279135)
Genome map
AA seq 337 aa AA seqDB search
MTRVAINGFGRIGRNFLRCWLGRTDSQLEVVGINDTSDPRTNAHLLRYDSMLGKLDADIS
ADENSITVNGKTIKCVSDRNPLNLPWAEWNVDLVIEATGVFVTHEGATKHVQAGAKKVLI
TAPGKGPNIGTYVVGVNAHEYKHEEYEVISNASCTTNCLAPIAKVINDNFGIIKGTMTTT
HSYTGDQRILDASHRDLRRARAAAVNIVPTSTGAAKAVALVIPELQGKLNGIALRVPTPN
VSVVDLVVQVEKNTIAEQVNGVLKEAANTSLKGVLEYTDLELVSSDFRGTDCSSTVDGSL
TMVMGGDMVKVIAWYDNEWGYSQRVVDLAEIVAKNWK
NT seq 1014 nt NT seq  +upstreamnt  +downstreamnt
gtgactagagtagcaattaacggatttggacggatcggacgcaactttctccgttgctgg
ctggggcgcaccgatagccagttagaagtagtcggtatcaacgacacctctgatcccaga
accaatgctcaccttttgcgctacgactccatgttgggtaagttggatgcggacatcagt
gccgacgaaaactccattaccgtcaatggcaagactattaaatgtgtttccgaccggaat
cccctcaatttgccctgggcagaatggaatgtagatctagtcatcgaagccaccggtgtt
tttgttacccatgaaggggccaccaagcacgttcaagccggagccaaaaaagttttaatc
actgctcctggcaaggggcccaacatcggcacctatgtggtgggggtcaatgcccacgaa
tataagcacgaagaatacgaagtaattagtaacgctagttgtactaccaactgcctcgcc
ccgatcgccaaagtaatcaacgacaattttggcatcatcaaaggcaccatgaccaccacc
cacagctacaccggagaccaacggatcctcgatgctagccaccgggatctacgccgggcc
cgggctgctgccgttaacatcgtgcccacctccaccggagctgccaaagcggtggccctg
gtaattcctgaactgcaaggcaaattgaacggtattgccctgcgggtgcccacccccaac
gtttccgtggtggatttggtagtacaagtagagaaaaacaccatcgctgaacaggttaac
ggagtgctcaaagaagcagccaacaccagccttaaaggagtgttggaatacaccgatttg
gaattggtttccagcgacttccggggcacggattgctcttccactgtggatggtagtctg
accatggtaatgggcggtgacatggttaaagtcattgcttggtacgacaacgaatggggc
tattcccaacgggtggtggacttggctgaaattgtggctaaaaactggaaatag

DBGET integrated database retrieval system