KEGG   Synechocystis sp. PCC 6803: sll1348Help
Entry
sll1348           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K18979  epoxyqueuosine reductase [EC:1.17.99.6]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03016 Transfer RNA biogenesis [BR:syn03016]
    sll1348
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.17  Acting on CH or CH2 groups
   1.17.99  With unknown physiological acceptors
    1.17.99.6  epoxyqueuosine reductase
     sll1348
Transfer RNA biogenesis [BR:syn03016]
 Prokaryotic type
  tRNA modification factors
   Other tRNA modification factors
    sll1348
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: DUF1730 Fer4_16 Fer4_10 Fer4_9 Fer4 Fer4_7 Fer4_8 Fer4_2 Fer4_17 Fer4_21 Fer4_6
Motif
Other DBs
NCBI-ProteinID: BAA17566
CyanoBase: sll1348
CYORF: sll1348
UniProt: P73526
Position
complement(1093626..1094495)
Genome map
AA seq 289 aa AA seqDB search
MGIAPVSETENDEAAQRLQSWIALGYNADMAWMANPKRQNIRELLPSARSVIAVGLNYYT
PHQRSGDPAHGKISRYAWGRDYHRVLTKKLKALNLWLEQQVPDLQSRYYVDTGPIQEKAW
AERAGLGWVGKNGNLISRDYGSWLFLGEIVTNITLQGDRPHSQHCGTCTRCLEACPTQAI
VEPFVVDSNKCIAYHTIENRAEILPTAIADNLQGWVAGCDICQDVCPWNQRFAQPTDVAD
FDPYEGNLNPELETLANITEADWQQQFTASALRRIKPAMLRRNAQANLQ
NT seq 870 nt NT seq  +upstreamnt  +downstreamnt
gtgggcattgcgccagtgtcggaaacggagaatgatgaagctgcccaaagattacagagt
tggattgccctgggctataacgccgatatggcttggatggctaatcccaaacggcaaaat
attcgggagcttttaccctcagcccggtcagtaattgcggtgggtttgaattattacact
ccccaccagcgcagtggagaccccgcccatggcaaaatttcccgctatgcctggggaagg
gattaccatcgggtgttaactaaaaagctaaaagcccttaatctctggctcgaacaacag
gtgccagatttacagagccgttattacgtagatacgggccccatccaggaaaaagcttgg
gcggaacgggccggtcttggttgggtaggaaaaaacggtaatttgatcagtcgggattac
ggcagttggttatttttaggggaaattgtcactaatatcactctccaaggcgatcgcccc
catagccaacattgtggcacctgcacccgttgcctagaagcctgtcccacccaggccatt
gtggaacccttcgtggtggacagcaataaatgcattgcttaccacaccattgaaaatcgg
gcagaaatcctaccaacggcgatcgccgacaatttgcaaggttgggtggcagggtgcgac
atttgccaagatgtgtgcccctggaatcagcgttttgcccaacccaccgatgtggcggat
tttgatccctacgagggcaatctcaacccagagttagaaactttagccaatatcaccgaa
gctgattggcagcaacagttcaccgcttcggccttgaggcgaataaaaccagctatgtta
cggcggaacgcccaggctaatctacaatga

DBGET integrated database retrieval system