KEGG   Synechocystis sp. PCC 6803: sll1352
Entry
sll1352           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF2079
Other DBs
NCBI-ProteinID: BAA17560
CyanoBase: sll1352
CYORF: sll1352
UniProt: P73520
Position
complement(1087772..1089190)
AA seq 472 aa
MEVSQSKPEGFLPPRSLLVGMAIGAVILFICATVRHWLFQSTALDLGFFDQAIYLISQGE
YPRVSFRGFHILGDHAAFLVYPIAIFYKIYPSVYWLFLIQAIALALGAWPTWQLAKQTGL
GEKESLTMALVYGLYPLIFNINLFDFHTEVIAVPALLWAVWSARANKWGIFLISLVTILA
SKAVLSLTVFMLGIWLLIWERKRLMGLITTVAGIAWFIITTKGIIPAFSGEEAAAVGRYS
FLGDSVAEIILNLILKPQIVLGMLFTLDNLFYLVLLTAPVIWGIWGKAWAMFIPAIPALF
VNLVTDYLPQKDLIHQYSLPILPFLLLVVMTHWYQGSSWLKKLRWIILWTAIAFLALGKY
TYFFGRYWHHWGQLANLQTAVSLVQPGDRVLTSPHLAAHLSHRPDLELAIEAEAPFDLNR
FDAVLLQTNYAGWENSQGTVEALAQRVSQDSAFTPEYQENEVILYRRAPSIP
NT seq 1419 nt   +upstreamnt  +downstreamnt
atggaagtaagccagagcaagcctgaaggatttttgcccccccgttctttgctggtcggg
atggcgatcggtgcagtcattctcttcatctgtgccacggtgcgccattggctgttccaa
tccactgctctcgatttgggtttctttgaccaggctatttatctgatcagtcagggggaa
tatccccgagtttcctttcggggtttccatattttgggggaccacgccgcctttttggtt
tatcccatagcgattttttacaaaatttatccctccgtttattggttatttctgatccag
gcgatcgccttagccttgggagcttggcccacttggcaattggcaaaacaaacgggactg
ggggaaaaagaaagtttaaccatggccttggtttatggcctatatcccctaatttttaac
atcaatttatttgactttcacactgaagtaatcgccgtacctgctctgctttgggccgtg
tggagcgctagggcgaataagtgggggattttcttaattagtttagtcacaatcttggct
agcaaagcagtactttccctcaccgtatttatgctaggcatttggttattgatttgggaa
agaaaaaggttaatgggactcattaccaccgtggcgggcattgcctggtttatcattacc
accaaaggtattattcctgcttttagcggagaggaagcagcggcggtgggtcgttatagt
ttcctgggggattccgttgcagaaattattttaaatttaattcttaaaccccaaattgtt
ttagggatgttatttaccctggataatttattttatttggtgctattaactgcgccggtt
atttggggaatttggggcaaagcttgggctatgtttatccccgccattcccgccctattt
gttaatttggtcaccgattatctgccccaaaaagatttaattcatcaatattcattgcca
attttgccctttttgctcctagtggtgatgacccattggtatcagggcagtagttggtta
aaaaagctccggtggattattctctggacggcgatcgcctttttagctttggggaaatac
acttattttttcggccggtattggcaccattggggacaattggctaacctacaaacggcg
gtgtccttagtgcaaccaggtgatcgggttttgacttcgccccacctggcggcccacctg
agccatcgaccagatttggaattagccattgaagcggaagctcccttcgatctgaaccgt
tttgatgccgtattgttgcagactaactacgctggttgggaaaattcccagggcacggtg
gaagccctagcccagcgggtgagtcaggattcagcttttacgccagaatatcaagagaac
gaggtaattctttatcgacgggccccttctattccctaa

DBGET integrated database retrieval system