KEGG   Synechocystis sp. PCC 6803: sll1353
Entry
sll1353           CDS       T00004                                 

Definition
(GenBank) sensory transduction histidine kinase
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: HATPase_c HisKA dCache_1 SKA1
Other DBs
NCBI-ProteinID: BAA17559
CyanoBase: sll1353
CYORF: sll1353
UniProt: P73519
Position
complement(1084757..1087753)
AA seq 998 aa
MGKFLDLLQKYWLLPCLLLAGYGGNYFKLHIFFGVDFLFGSIATLLVLVCYSLPWGLVSA
AIAGSHTLIIWRHGYGILIIILEALVVGLMLRRRQTNLVLINSLFWLLIGIPLVYIFYRW
GLNMTSVTTSLITLKQATNGIFNSLIASFLITGFGLSKQKFSPSTNPAFFPWKKLSFEQT
LFNLLVAFVFFPLFFITVVNGQEAFVQMEKQTVQELTALSIPIQNSVEDWYQSHLEGAEV
FATEILPLVAAINQGNGAQLPALSLMTHTIQTAFTGFSNIYVGDRQGQIIASSPEFNEVG
ESRLGLIQAEKIAGFSIPSQIQVSPLHRTNVNVDPHVAITIPLVANNSFEGFINASLNLA
KMKDLLYANRVSKELNITLINGQNQVVASTIANVLPLEIYQPFEGGDPRDLGSSNYHWYP
DTPANPTIRWRDSYYYHILPLDKINDWQLVLGLPARESIEKLQAQSVQKLGLLLFLSLVG
LVVAIGVSKRVANPLLTLAKITTDIPTKMQYQGLTPIALRSEVSEVITLNENFNEMLITL
QNQFKIIKQAKDNLEMRVAERTHTLIVINKQLAGEIEERQRIEIKLREAKESAELANRVK
SEFLANISHEIRTPMNAILGFCDLLLQKDLSLSQTKKYLNAIGSSSKILLALIDDILDIS
KIEAGKLVIHLEPVDLRVIIREIKQIFDYKAESKSLLLTIQIDETLNQAIYFDAVRLRQI
LFNLVGNALKFTEEGQVFIYIGVEGIQVRSQGTYISLAIEVTDTGIGIAPEDQAKIFDVF
TQSQGQSTRKYGGTGLGLTITRRLTALLGGEISLSSRLGEGSTFILHFPAVRLVENSLKS
DLTNGDGGNLTDRLGSMSSSSANTTEKLLPTRVGNMAPDNNSLGNHNGPSQGFPRAVPLI
DQAQRQQLISLLEQEETNVWNKLRHTLISRQIRNFGDRLSSWGNEYGWEDLHTYGQSIIK
ALENFDSRRLEQLMGQFPQYRASLTEVSAGVDGKHASE
NT seq 2997 nt   +upstreamnt  +downstreamnt
atgggcaaatttcttgatctcctacaaaaatactggcttttgccctgccttttgctagcg
ggttacgggggaaactatttcaagttacatatattttttggagttgattttctttttggc
agcattgccactttactggttttggtttgctatagcttgccctggggtctagttagtgcg
gcgatcgccggtagtcacaccctgatcatttggcgccatggctacggcatattaataatc
atcctggaagccctggtggtgggcttgatgttgcgccgccggcaaacaaacttagtccta
attaatagtctcttttggctattaattggcataccgttggtttatattttttaccgttgg
ggcttaaatatgacctcggttaccaccagtttaatcactcttaagcaagctaccaatggc
atttttaatagtttaattgccagttttttaatcactggctttggtttgtcgaagcagaag
ttttccccctcgactaatccagctttttttccctggaaaaaactgtcttttgagcagact
ttgtttaatttgctggtggcatttgtctttttccccctcttttttatcactgttgttaat
ggtcaagaagcttttgtacaaatggaaaagcaaacagtccaagaactaacagctttatcc
atacccattcaaaattctgttgaggattggtatcaaagtcatctggaaggagcagaggtt
tttgccaccgaaatcttacctttagtagctgcaatcaaccagggtaatggggcgcaacta
cctgcccttagccttatgacccacaccatacaaacagcttttactggctttagtaatatt
tatgtcggcgatcgccaggggcaaattattgccagttctcctgaatttaatgaagtggga
gaatcacgactaggactgattcaagcagaaaaaatagctggtttttccattccctcgcaa
atacaagtatctccactacaccgcaccaatgtgaacgtcgatccccatgtggctatcact
attccactagtggctaacaatagctttgagggctttattaatgcttctttaaacctggct
aaaatgaaagaccttctatatgcaaatagggtcagtaaggaattaaatattaccctcatc
aatgggcaaaatcaagtggtagccagcaccattgctaatgtattaccattggaaatctat
caaccttttgaggggggagaccctcgggatttaggctcatcaaattaccattggtatccc
gatacaccggctaatcctaccatccgctggcgcgactcctattattatcatattttgccc
ttggataaaattaatgattggcaattagtgcttggtttgcccgctcgggaaagcatcgaa
aaactacaggctcaatcagtacaaaaattgggcttgctattatttttaagtctagtgggt
ttggtggttgccattggtgtgagtaagcgggtagctaatccattattaactttagctaaa
atcaccactgacattcccactaaaatgcaataccaaggcttaactcccattgctctccgt
agtgaagtcagcgaagtaattactctgaatgaaaactttaatgaaatgctgattactttg
caaaatcagtttaaaatcattaagcaggccaaggataacttagaaatgagagtggcggaa
agaacccacactttaattgtgattaataagcaactagcgggggaaatcgaagaacgtcag
cgcattgaaattaagttgagggaagcaaaggaaagtgccgaattagccaaccgtgttaag
agtgagtttttagctaatattagccatgaaattcggactccaatgaatgctattttgggt
ttttgcgacttacttttacaaaaagatcttagtttgtcccaaaccaagaaatatctcaat
gccattggttctagtagtaagattttgttggcactgatcgatgacattttagatatttct
aaaattgaagcaggcaaattagtcatccatctagagccagtagatttaagggtaataatt
agggaaatcaaacaaatttttgattacaaagctgaaagcaagagtttgttgttaactatc
caaatagatgaaaccttaaaccaagctatttattttgatgcggtacgtctgcgacaaatt
ttatttaatttagtgggtaatgctcttaaatttacggaggagggacaggtttttatttac
attggcgtggaaggcattcaagtccgttcccagggcacctatatttctctagccattgaa
gtcactgacacgggcatcggcattgctccagaagaccaagcgaagatttttgatgttttc
acccaaagtcagggccagagcactcgcaaatatgggggcacaggtttgggcttgaccatt
actaggcgcttgactgcattattagggggagaaataagtctttccagtcggctgggggag
gggagcacgtttattttgcatttcccagcggtacgtttggtggaaaattcactcaagtcc
gacctcaccaatggtgatgggggaaatttaaccgatcgcctagggtcgatgtcttcatct
tccgccaatacaacggaaaaacttttgcccactagggttgggaatatggcccctgacaac
aactccttaggcaaccacaacgggcctagccaaggcttccctagggcagtccccctcatt
gaccaagcccaacgacaacaattgatttctctgctggaacaggaagaaactaatgtttgg
aataaattacgccataccctcatttcccggcaaataagaaactttggcgatcgcctttca
agttgggggaacgaatatggctgggaagatttacacacctatggtcagagcattatcaag
gctttggaaaattttgatagccgtcgattggagcaacttatgggtcaatttccccaatat
agagctagtctgacggaagtttctgccggagtggatggtaagcatgcttccgagtag

DBGET integrated database retrieval system