KEGG   Synechocystis sp. PCC 6803: sll1354
Entry
sll1354           CDS       T00004                                 

Gene name
recJ
Definition
(GenBank) single-strand-DNA-specific exonuclease; RecJ
  KO
K07462  single-stranded-DNA-specific exonuclease [EC:3.1.-.-]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn03410  Base excision repair
syn03430  Mismatch repair
syn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:syn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03410 Base excision repair
    sll1354 (recJ)
   03430 Mismatch repair
    sll1354 (recJ)
   03440 Homologous recombination
    sll1354 (recJ)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03400 DNA repair and recombination proteins [BR:syn03400]
    sll1354 (recJ)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.-  Acting on ester bonds
    3.1.-.-  
     sll1354 (recJ)
DNA repair and recombination proteins [BR:syn03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   BER (base exicision repair)
    RecJ
     sll1354 (recJ)
  DSBR (double strand breaks repair)
   HR (homologous recombination)
    RecFOR pathway proteins
     sll1354 (recJ)
   NHEJ (non-homologous end-joining)
    SHDIR (short-homology-dependent illegitimate recombination)
     RecET pathway
      sll1354 (recJ)
SSDB
Motif
Pfam: DHHA1 RecJ_OB DHH
Other DBs
NCBI-ProteinID: BAA17558
CyanoBase: sll1354
CYORF: sll1354
UniProt: P73518
Position
complement(1082437..1084716)
AA seq 759 aa
MAQFRWQLIPPVTPPAIFVEQVRRHCGQSSGQFAAQLLWQRGIQSADQLGGFLSPDCYTP
TSPWEFGQEMKWAVQRLGQAMAQKEKVTIWGDFDADGITSTAVLWEGLGQFFPQDSQLTY
TIPNRLRESHGLNRPGLERLATQGTKLIVTCDTGSTNLDEIVYAQQLGMDVIVTDHHTLP
DDRPEVVAIINPRYFADGHPLFNLSGVAVAFKLVEALYNQYPTVPQQPLEDLLDLVAIGL
IADLVTLQGDCRYLAQRGIAQLRTQKDPATATRPGIHALLNLCNRNGDRPTDIGFGIGPR
INAISRIKGDASFGVELLTSRDTKVCNQLAAEAETLNSRRKGLQKSVIIEIDQRLQNIDL
STTGVVVLTDPQWPTGVLGLAASHVAQTCGRPAILLNTQDGKIAKGSARSVANIDLYALL
HSQRHLMLGFGGHPFAAGLSLPLDKLPLFTEAVNQQFWQSYGAQISLDPILAVDLQVKVA
DLGQDLFREFNLLEPYGMGNPAPKLLLENVQVGRPSFRNIKDRTGNKVSYLKTSFRVTDY
PPKTDDDGQVVQCPGVWWGHHPDELPQNEPLDLVVELDFNTYDRQYEVRLIDFRLHQPQG
IAPSQTSTNLIDRRSPHAPDQDLSPQGHVLRTCPSSWSELRRAYQQAIAAQQPLVLDYHF
LPQCPSSLVAELEAQWHGRETAQLSPLSLQKQWDFSHGLASQILVLIQEYGPALNSGSAW
PKALVRQIETLIAEEQFQKQYFSQVSLTPELLATVPDKP
NT seq 2280 nt   +upstreamnt  +downstreamnt
atggcccaatttcgttggcagttaattccccctgttactcccccggctatttttgtcgaa
caggtgcgtcgccattgtggccaatccagcggtcaatttgccgcccaattactgtggcaa
aggggcattcagtcagcggatcagttgggtgggtttctttccccggattgttatactccc
accagcccttgggaatttggccaggaaatgaaatgggctgtacaaaggttgggccaggcc
atggcccagaaggaaaaagtcaccatttggggggatttcgatgccgacggcattacttcc
actgcagtgttatgggaaggattggggcaattttttccccaggatagccagttgacctac
accatccctaaccgtttacgggagtcccacggcctcaaccgaccgggactagaacgctta
gcaacccagggtacaaagttaattgtcacctgcgacactggcagtacaaatttggacgaa
attgtctatgcccagcagttgggcatggatgtaattgtcaccgaccaccatacgttgcca
gacgatcgcccggaggtggtggccattattaacccccgttactttgccgatggccatccc
ctgtttaacctttccggagtagcagtggcttttaagttggtggaagctctctacaaccaa
tatcccacagtgccccaacaacccttggaggatttactagatttagtggcgatcggtcta
attgccgatttggttaccctgcaaggtgattgtcgttacctagcccaacggggcattgcc
caactccgtacccaaaaagatccagccactgccacccgccctggcatccatgccctactt
aacctttgcaatcgcaacggcgatcggcccacagacattggttttggtattggcccccgc
atcaacgccatcagtcgcattaaaggggatgctagctttggagtagaactactcaccagt
cgggacacaaaagtttgtaaccaattggcggccgaagcggaaaccctcaacagtagacgc
aagggattacagaaatctgtcattatcgaaattgaccaacgactccaaaacattgaccta
tccaccaccggggtagtagtactcaccgatccccagtggcctacaggggttttgggccta
gccgccagtcatgtagcccaaacctgtggccgtccggccattttgctcaacacccaagat
gggaaaattgccaaaggatcagcccgttctgtggccaacattgacctttatgccctactg
cacagtcaacgacatttaatgctgggctttggaggccatccctttgccgccggtttgagc
ttgcctttggataaattgccgttgttcacggaagcggtcaatcaacagttttggcaaagc
tacggagcccagatcagcttggatccgattctggcagtggatctccaagtgaaggtggca
gatttaggacaggacctctttcgggaatttaatttgcttgaaccctatggcatgggtaac
cccgcacccaaactactactggaaaatgtgcaagtcgggaggcccagctttcgcaatatc
aaagaccgcactggtaataaagtgtcctacctaaaaaccagctttcgggtaacggactat
ccgcctaaaaccgatgacgatggccaagttgttcaatgccctggggtttggtggggccac
catcccgatgaactgccccaaaatgaaccgttggatctggtggtggaattagacttcaac
acctacgaccggcagtatgaagtgcgcctgatcgatttccgcttacatcaaccccaagga
attgcccctagtcaaactagtaccaatttaattgaccgccgttccccccatgccccagac
caggatctttctccccaaggtcatgtcctccgcacctgtcccagcagttggtcagaattg
cgccgggcctaccaacaggcgatcgccgcccagcaacccctagtgttggattatcatttc
ttaccccaatgccctagtagcttagtggccgaactagaagcccaatggcatgggcgggaa
acggcccaactttctcccctcagcttgcaaaaacaatgggattttagccatggcttagca
agtcaaattctggtcctaatccaagagtacggcccagcgttaaactcaggcagtgcttgg
ccgaaagctttggtccgccaaattgaaactttaattgcagaagaacaattccaaaagcaa
tatttcagccaggtgtccctaacccccgagcttttggccaccgtacccgacaagccatga

DBGET integrated database retrieval system