KEGG   Synechocystis sp. PCC 6803: sll1355
Entry
sll1355           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Uma2
Other DBs
NCBI-ProteinID: BAA17553
CyanoBase: sll1355
CYORF: sll1355
UniProt: P73513
Position
complement(1076474..1077019)
AA seq 181 aa
MQIMQSPLLTDNLDLFLQRAEIEASPAWEFIRGQAQQKPMPTLFHSRLQRNLVNVINAQT
RDYEAIQELRCIVPPFSPVPDIAVVKSNLLAEEDGPLKGAPDWLIEILSPDQNILSLQTK
ILHCLTNGTKLAWLIDIYRQQIWVWNQESLPLIYQGLENPPTLDNLLTLTVNDVMAMTRQ
R
NT seq 546 nt   +upstreamnt  +downstreamnt
gtgcagataatgcagtcacctctgctcactgacaatctcgatctgtttctacaacgcgca
gaaattgaggcttccccagcctgggaatttatccgggggcaggcccagcagaaacccatg
ccgacgttgtttcattcccgcctacagcgtaatctggtcaacgtcattaatgcacaaacc
agggattatgaggccattcaggaattgcgctgtattgtgcccccattttcccccgtacct
gacattgccgttgtaaaaagcaatctcctggcggaggaagacgggccattgaagggagcg
ccggactggttaatcgaaattctgtcccccgatcaaaatattcttagcctgcaaaccaaa
attctgcattgtttgactaatgggacaaaactcgcttggctcattgatatttatcgtcaa
caaatctgggtttggaatcaggaatcgttacctttaatttatcagggactggaaaatcca
cccacgttagacaatcttttgactttgactgttaatgacgtaatggccatgacccgacaa
cgctaa

DBGET integrated database retrieval system