KEGG   Synechocystis sp. PCC 6803: sll1356Help
Entry
sll1356           CDS       T00004                                 

Gene name
glgP
Definition
(GenBank) glycogen phosphorylase
  KO
K00688  glycogen phosphorylase [EC:2.4.1.1]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00500  Starch and sucrose metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00500 Starch and sucrose metabolism
    sll1356 (glgP)
Enzymes [BR:syn01000]
 2. Transferases
  2.4  Glycosyltransferases
   2.4.1  Hexosyltransferases
    2.4.1.1  glycogen phosphorylase
     sll1356 (glgP)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Phosphorylase
Motif
Other DBs
NCBI-ProteinID: BAA17551
CyanoBase: sll1356
CYORF: sll1356
UniProt: P73511
Position
complement(1073080..1075629)
Genome map
AA seq 849 aa AA seqDB search
MEHLPMAFNTTNPLIQVEDDRTGLSVETLKRALADNLFYLQGKFPAIATKNDCYMALAYT
IRDRLLQRWLNTFQTYLNCDNRVVCYLSAEYLLGPHLGNNLINLGLWEPVQQAVEESGLS
LDELIDIEEEPGLGNGGLGRLAACFMDSLATLEIPAIGYGIRYEFGIFDQEIKDGWQVEI
TDKWLQLGNPWEIARPESAVLVKLGGHTEPYTDDQGNYRVRWIAGSLVKGIPYDTPILGY
KVSTANNLRLWKSEAAESFDFQRFNVGDYYGAVQDKMSSENLTKVLYPNDEQIQGKELRL
AQQYFFVSCSLQDMIRIHLSDNPTLENFHEHFAVQMNDTHPSIAVAELMRLLVDEHHYEW
QRAWAITEATFGFTNHTLLPEALEKWSLPLFGEMLPRHLEIIYEINQRFLDQVRMKYPND
GDRLARLSIIDEAGEKSVRMAYLATVGSHAINGVAALHSQLVKETILKDFYELWPEKFSN
KTNGVTPRRWMVLSNPRLSNLISSRIGDGWIKNLDELKQLEPFADLAGFRQDWCKVKREV
KQDLARYIHTRTDLVVNPDSLFDVQVKRIHEYKRQHLNILHVIHLYLQIKNNPNLDVTPR
TFIYGGKAAPGYFTAKLIIKLINSVADVVNNDPTIGDRLKVIFLPDYNVKFGQRVYPAAD
LSEQISTAGKEASGTGNMKFSMNGALTIGTLDGANIEIREEVGAENFFLFGLTTPEVEKT
LAEGYQPWEYYNNNANLKAVVDLINSGFFSHGDTALFRPLMDSLLGQDPYLVFADFQAYV
DCQNQVGEAYKDQENWARMAILNVARMGKFSSDRTIREYAEDIWAIKPVVIELEDLCPDG
QCLLISPNK
NT seq 2550 nt NT seq  +upstreamnt  +downstreamnt
atggagcaccttcccatggcttttaacaccaccaatcccctcattcaggtggaggatgac
cgcactggtctgagcgtggaaaccctcaagcgggctttggcagacaatttgttttatctc
cagggtaaatttcccgccattgccactaaaaacgattgttatatggccctggcctacact
atccgcgatcgcctcctgcaacggtggttaaatacattccaaacctatctcaactgtgac
aatcgggtggtgtgctatctgtcggcggaatatttgctggggccccatttgggtaataac
ctaattaatttagggctatgggagccggtgcaacaggcggtggaagaatcggggttgagc
ttggatgagttaattgatattgaagaagaaccggggttgggcaacggtggtttaggtcgt
ttggccgcctgctttatggattccctggctacgttggaaattccggcgatcggctacggc
atccgctacgaattcggtatctttgaccaggaaattaaagacggttggcaggtggaaatc
actgataaatggctccaactgggtaatccttgggaaattgcccgtcctgaatccgctgtg
ttagtcaaactggggggccatacggaaccctacaccgatgaccaaggtaattatcgggtg
cgttggattgccggcagtttggtcaaaggcattccctatgacactcccattttgggctac
aaagtcagcaccgccaataatttgcgcctgtggaaatcggaagcggcggaatcctttgat
tttcaacggtttaatgtgggggattattacggggcagtgcaggacaaaatgtcctcggaa
aatctcactaaagtgctctatcccaacgatgaacagattcaggggaaagagttacggctg
gcgcaacaatacttttttgtttcctgttctttgcaggacatgattcgcattcacctgtcg
gacaatcccaccctggagaatttccacgaacattttgcggtgcagatgaatgacacccat
ccttccattgcggtggctgaactgatgcgtctgttggtggatgagcatcactatgaatgg
caacgggcttgggccattaccgaagccacctttggttttactaatcacactttgctaccg
gaggcattggaaaaatggtctttgcccctgtttggcgaaatgttaccccgccatttggaa
attatttacgaaatcaaccaacgtttcctagatcaagtacggatgaaatatcccaacgat
ggcgatcgcctggcccggttatccatcattgacgaagcaggagaaaagtcggtgcggatg
gcctatctggccacggtgggttcccatgccattaatggggtggcggcgttgcatagtcaa
ctggtgaaggagactattcttaaagacttttacgaactttggccagaaaaatttagcaat
aaaaccaacggcgttaccccccggcgctggatggtgctcagtaatccccgcctgagtaac
ttaatttcttcccgcattggtgatggctggattaaaaatttagacgagctaaaacaactg
gaaccctttgctgatttggctggattccgacaggattggtgcaaagttaagcgggaagtt
aagcaggatttagctcgctatatccacaccagaactgacttagtggttaatcccgattcc
ctgtttgatgtgcaggtaaaacgaatccatgaatataaacggcaacatttgaatattctc
cacgttatccatctttatttgcagattaaaaataatcctaatctggatgttacaccccgt
acttttatctatggtggtaaagcagcccccggttattttaccgctaaattaatcatcaag
ctgatcaactccgtggcagatgtagttaataatgaccccaccattggcgatcgcctgaaa
gttatctttttgccggactataacgttaaatttggccaaagggtctatcccgccgctgat
ctttccgagcaaatttccaccgctggcaaagaagcttccggcaccggcaatatgaaattt
tccatgaatggagctttaaccattggcacattggacggggcaaatattgaaattcgagaa
gaggtgggggcagaaaactttttcctctttggcctcaccactccagaagtggaaaaaacc
ttggcggaaggctatcaaccttgggaatattacaacaataatgccaacttaaaagctgtg
gtagatctgattaattctggctttttctcccatggtgacacagcattatttcgcccctta
atggattccttgttgggtcaagacccataccttgtatttgccgatttccaagcctatgtg
gattgtcaaaaccaagtgggagaagcctataaagatcaggaaaactgggctcgcatggcc
atcttaaatgtggctcgcatgggtaagttttcctcggatcgcactattcgggaatacgcc
gaagacatctgggctatcaaacccgtggtaattgaattagaagacctctgtcccgatggt
caatgtttgttaatttctcctaataaatag

DBGET integrated database retrieval system