KEGG   Synechocystis sp. PCC 6803: sll1358
Entry
sll1358           CDS       T00004                                 

Definition
(GenBank) unknown protein
  KO
K01569  oxalate decarboxylase [EC:4.1.1.2]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00630  Glyoxylate and dicarboxylate metabolism
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00630 Glyoxylate and dicarboxylate metabolism
    sll1358
Enzymes [BR:syn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.1  Carboxy-lyases
    4.1.1.2  oxalate decarboxylase
     sll1358
SSDB
Motif
Pfam: Cupin_1 Cupin_2 Cupin_3 EutQ MannoseP_isomer Cupin_8 GPI
Other DBs
NCBI-ProteinID: BAA17550
CyanoBase: sll1358
CYORF: sll1358
UniProt: P73510
Structure
PDB: 
2VQA

Position
complement(1071734..1072918)
AA seq 394 aa
MVNSVIGWLRRRFLLVGLSVLLITFLGIFTPTIAQSEQWRSLSNVVWGKDLPAFTYAFSK
TPLVLYDGGTTKQVGTYNFPVSKGMAGVYMSLEPGAIRELHWHANAAEWAYVMEGRTRIT
LTSPEGKVEIADVDKGGLWYFPRGWGHSIEGIGPDTAKFLLVFNDGTFSEGATFSVTDWL
SHTPIAWVEENLGWTAAQVAQLPKKQVYISSYGPASGPLASATPQGQTAKIEVPHTHNLL
GQQPLVSLGGNELRLASAKEFPGSFNMTGALIHLEPGAMRQLHWHPNADEWQYVLDGEMD
LTVFASEGKASVSRLQQGDVGYVPKGYGHAIRNSSQKPLDIVVVFNDGDYQSIDLSTWLA
SNPSSVLGNTFQISPELTKKLPVQDTIFSLPTQP
NT seq 1185 nt   +upstreamnt  +downstreamnt
atggtcaactcggtaataggatggttgagacggcggtttttactagtaggattgagtgtt
ttactgataacttttttagggatttttactccaaccattgcccaaagtgaacaatggcga
tcgctctccaacgtggtttggggtaaggatttaccagcttttacctatgcctttagcaaa
actcccctagtgctttacgacggcggcaccactaaacaggtgggtacctataactttccc
gtcagcaaggggatggcgggggtttatatgagcttggagcccggagcgattcgggaatta
cattggcatgccaacgcggcggaatgggcctatgtcatggaaggcagaacccggattacc
ctcaccagtcccgaaggcaaagtggaaattgccgatgtggacaaaggagggctttggtat
tttccccggggttggggccacagcattgagggcattggtcccgacactgccaaatttttg
ctggtattcaacgacggcaccttttctgaaggggcaacctttagcgttactgattggctt
tcccacactccgatcgcctgggtggaagaaaatttaggttggacggcggcccaggtagcc
caattacccaaaaaacaggtttacatttcctcctacggcccggcttctggccccttggct
agcgcaactccccaggggcaaacggccaaaattgaagttccccacacccataatctcctg
gggcaacaacccctagtttccctgggtggcaacgaattgaggctagccagcgccaaggaa
tttcccggcagttttaatatgaccggcgctttaattcatttagaaccgggagccatgcgt
caactccattggcatcccaacgcggacgagtggcaatatgtgctcgatggggagatggat
ttaaccgtttttgcttccgaaggtaaagccagcgttagtcgtctccagcagggagatgtg
ggctatgtgcccaagggttatggccatgccatccgcaacagttcccaaaagccgttggat
attgtggtggttttcaatgatggggattatcaaagtattgatctgagtacttggttagct
agcaatcctagctcggtgttggggaatactttccaaatttcgccggaattaactaaaaag
ttaccagtgcaagacacgattttttctctaccaacccaaccataa

DBGET integrated database retrieval system