KEGG   Synechocystis sp. PCC 6803: sll1359
Entry
sll1359           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Cytochrome_CBB3 Cytochrom_C
Other DBs
NCBI-ProteinID: BAA17549
CyanoBase: sll1359
CYORF: sll1359
UniProt: P73509
Position
complement(1069666..1071702)
AA seq 678 aa
MKIGRITAYALVVIIFVLFFSLVTPVSSKTVATITLPGVCNAKLSPLAISWQLPADVEGE
LKQKNFNVVQRAVDTFAWQEFIALNWPAIVGDGDRGVPDKNLAINAPGPRVWETWKETSE
VYLPNGAVPQPWNSNEPLPNGLKGDGRTKILFRQSKVDEVLNDEFQPTKADGALPGTLTD
QWGNVVRYEIRMNKVLFDYVVKNKLYNPEQQALLPEINAPDGSILIKAAWREITPEESGR
FHNVPAYVQDLTTGKYQLQQMGLVGFHIMYKTPSAPQWIWSTYEQVDNVPGLNHSGSANT
VFSFHGDRCVNCLTNKQTILGVPNQVTRRTPIPHQDPDCSQPTKAVDNVAELNRLVQAGL
KDSVWANYELINAQWAIPKSAADKSPDTVFHVLPALLANTTMETYIQGTSSCMGCHAMAR
SSNVKKFASADFSFTFADALPTQIDPQVVSPPDEPVTAWDNQHWNSILRGYQLTTETYEE
MPEFVLTAKLHCASCHLNAGANPKASSWFGMMKKYQYPETINLQKRINLCFEHSLNGKPL
TITADSPDFQAFISYMQWLDEQAEVLNIDLPKTPYPPIAKLTGNPNQGQAIFEQKCAFCH
GALGQGRYGSDTYYRPALWGPNSFNRQAGMARINTLAEFIHGNMPYQFDGVLTDQEAWDL
ATYIDGQPRPEGPGSRQN
NT seq 2037 nt   +upstreamnt  +downstreamnt
atgaaaataggaagaattacggcctatgccctagttgtgattatttttgtgctgtttttt
tccctggtaactccagtaagctctaaaaccgttgctactattactttgcctggggtttgt
aatgccaaattatctccccttgccatcagttggcagttaccggcagacgtggaaggggaa
ctcaagcaaaagaatttcaatgttgtccaacgggcggtggatacctttgcttggcaagaa
ttcattgccctaaactggcccgctatagttggcgacggcgatcggggagtgccggataaa
aatttagccatcaatgctcccggcccaagggtgtgggaaacctggaaagaaaccagcgaa
gtttatttgcccaatggcgcagtgccgcagccatggaatagtaatgaacctttacccaat
ggtttgaaaggagatggaagaacgaaaattttatttcgtcaaagcaaggtggatgaagta
ctcaatgatgaatttcaacccaccaaagctgatggggcattgcccggaactttgaccgat
cagtggggcaatgtggtgcgctatgaaattcgcatgaataaggtgttgtttgattatgtg
gtgaaaaataaactttacaacccagaacaacaggctcttttacccgaaattaatgcccct
gatggctccattttaattaaggccgcttggcgggaaattaccccggaggaatccggccgt
tttcacaatgtaccggcctatgtgcaggatttaaccacagggaaatatcaactgcaacag
atgggtttggtgggatttcacattatgtataaaactcccagtgcgccccagtggatttgg
tccacctatgaacaggtggataatgtccccggtttaaaccacagtggttctgccaatacc
gttttctccttccacggcgatcggtgcgttaattgcttgaccaacaaacaaaccattctt
ggtgttcccaaccaagtcactcgccgaactcctattccccaccaagacccggattgcagt
caacccaccaaagcagtggataacgttgccgagcttaaccgccttgtacaagcagggtta
aaagattccgtttgggccaattatgaattaatcaatgctcaatgggctatccccaaatca
gcggcggataaaagccccgacaccgtttttcacgttctaccagccctgttagccaatacc
accatggaaacctatatccaggggacatcttcctgtatgggatgccacgccatggcccgg
agtagtaatgtcaaaaaatttgcttcggcggattttagttttacctttgccgatgccctc
ccgacccaaattgatcctcaagttgtttctccccccgatgaaccggtaacggcttgggat
aatcagcattggaatagtattctgcggggctatcaattaacgaccgaaacctatgaggaa
atgccagaatttgtgctcactgccaagcttcattgcgctagttgtcacctcaatgccggg
gctaatccgaaagcatcttcctggtttggcatgatgaaaaaatatcaatatccagaaacc
atcaatttacagaaacggatcaatctttgttttgaacatagcctcaacggcaaacctctg
accattaccgccgatagtcccgatttccaagcttttatcagctatatgcagtggctggat
gaacaggcagaggtattgaacatcgatttgcccaaaaccccctatccccccattgccaaa
ctgacggggaatccaaatcaaggccaggcaatttttgagcagaaatgtgctttttgccac
ggtgcgttgggccagggtcgctatggcagtgacacctattatcgcccagccctatggggc
cccaattccttcaatcgccaagcggggatggcgaggattaatactttggcagaatttatc
cacggtaatatgccctatcaatttgatggagtgttgacggatcaagaggcctgggattta
gctacctacattgatggtcaaccaagaccggaagggcccggatcacgccagaattga

DBGET integrated database retrieval system