KEGG   Synechocystis sp. PCC 6803: sll1360
Entry
sll1360           CDS       T00004                                 

Gene name
dnaX
Definition
(GenBank) DNA polymerase III subunit
  KO
K02343  DNA polymerase III subunit gamma/tau [EC:2.7.7.7]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn03030  DNA replication
syn03430  Mismatch repair
syn03440  Homologous recombination
Brite
KEGG Orthology (KO) [BR:syn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    sll1360 (dnaX)
   03430 Mismatch repair
    sll1360 (dnaX)
   03440 Homologous recombination
    sll1360 (dnaX)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:syn03032]
    sll1360 (dnaX)
   03400 DNA repair and recombination proteins [BR:syn03400]
    sll1360 (dnaX)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.7  DNA-directed DNA polymerase
     sll1360 (dnaX)
DNA replication proteins [BR:syn03032]
 Prokaryotic type
  DNA Replication Elongation Factors
   Elongation factors (bacterial)
    DNA polymerase III holoenzyme
     sll1360 (dnaX)
DNA repair and recombination proteins [BR:syn03400]
 Prokaryotic type
  SSBR (single strand breaks repair)
   MMR (mismatch excision repair)
    DNA polymerase III holoenzyme
     sll1360 (dnaX)
SSDB
Motif
Pfam: DNA_pol3_delta2 Intein_splicing DNA_pol3_gamma3 AAA RuvB_N PT-HINT AAA_16 AAA_18 Herpes_Helicase AAA_11 AAA_22
Other DBs
NCBI-ProteinID: BAA17547
CyanoBase: sll1360
CYORF: sll1360
UniProt: P73507
Position
complement(1065660..1069010)
AA seq 1116 aa
MAYEPLHHKYRPQTFADLVGQTAIAATLSNAIEQERIVPAYLFTGPRGTGKTSSARILAK
SLNCIAGDRPTATPCGQCATCRAITNGSALDVIEIDAASNTGVDNIREIIERAQFAPVQC
RYKVYVIDECLTGDSQVLTRNGLMSIDNPQIKGREVLSYNETLQQWEYKKVLRWLDRGEK
QTLSIKTKNSTVRCTANHLIRTEQGWTRAENITPGMKILSPASVDVDNLSQSTALTASLG
GLSGAINYEAINTDKKNTTLSLSLKKQKPQDPFVNADVAKNLIFQHFCSAKEEKLKVSNP
IGEDIPTKKATDFGISEQKKLHQGQNRWEQKFSVLSTEPCLGMEVLTIPTHIADSPACDG
PTAPSSQNGWNIKRQDWDVCHPKYDSQPIKAMGKVPSAVKPVVPQTLLMFSAQSNLEVKE
NKFLRNGSRISLKKEWLGGTWTTVPSLFPNLGVHQFSYTQRAFSRKKINLLLNGLPIEDI
PPVQNPIAEALTAKPITTQKWEQWPPASGYRTWKSIPSPQWHTNFEEVESVTKGQVEKVY
DLEVEDNHNFVANGLLVHNCHMLSTAAFNALLKTLEEPPERVVFVLATTDPQRVLPTIIS
RCQRFDYRRIPLQAMVDHLRYIAGRENINIDQPALTLVAQIANGGLRDAESLLDQLSLLP
DLITPDKVWDLVGAVPEQDLLALLEAIASDDAETLLATCRQILNRGREPLVVLQNLASFY
LNLLIAQTAPQRSDLVAVTAETWQALCDTAPQWQRGVILQGQQKLKESEIQIRNTTQPRL
WLEVTLLGLLPSACGLDTGAVSQTAVRTPVAQPITPPKPSNVVTFPGGSHNHLTVVDSPT
MIPVSEPIVLEEKLEADVEPSSFEPSNAHWDLTQLWSETLNNLGALSQSLFKSFGSLINL
VGNNATVSVTTQQLLKIAAGKKDELEAALGQACGQSVKVNLVVGKPSTPETTPVNSAPPP
SHSKPPAFAPEPSPPPTAAVNANPAPTVPPSPPAIARGPATSEIKPSPRRESNNFSNPSR
PKPKPAPAMEEPPPTDIGDSATRKAIEQFAKNFDGEIVASDAAPKQESDNGDDLSTEPTA
ELGQQPMDHNGHLQINQPTVLNRPAIAPEEEEDLPF
NT seq 3351 nt   +upstreamnt  +downstreamnt
atggcctacgaacctctgcaccataaatatcgcccccagacctttgcagatttggtgggc
caaacggcgatcgccgccacattgagcaatgccattgaacaggagcgcatcgtacctgct
tacctatttacgggccccaggggaacgggaaaaacttcttcagcccgaattttagccaaa
tccttaaactgcatcgctggcgatcggcctactgccactccctgcggccaatgtgccacc
tgtcgggctattactaacggttcagctttagacgtaattgaaattgatgcggccagtaat
acaggggtagataatatccgagaaattattgaacgggctcaatttgccccagtacagtgc
agatataaagtatatgtgatcgatgaatgcttaacgggggactcacaagttttgacccgc
aatggcttaatgtccattgacaatccccaaataaaagggcgagaagttctgagctacaac
gaaactctacagcaatgggaatataaaaaagttttaagatggcttgacagaggcgaaaag
caaacattgtctattaagacaaaaaattctacagtacggtgtacggctaaccatttaatc
agaactgaacaaggatggacgagagcggaaaacatcactcccggaatgaagatactatcc
cctgcgagtgtggatgtggacaatttatcgcaaagtacggcactgaccgcaagcttaggc
ggtttgtccggggccatcaactacgaggcaatcaatacggacaaaaaaaatacgacctta
tctctatccttgaagaagcagaagccacaagacccttttgtcaatgcggatgtggcgaaa
aacttgatattccagcatttttgcagtgcaaaggaagagaaattaaaagtatccaatccc
attggcgaagacatccctacaaaaaaagccacggactttgggatctcagaacagaaaaaa
ttacatcagggtcagaaccgttgggagcagaaattctcggtcttatctacggaaccttgc
ttggggatggaagtattgactatcccaacccacatagccgattcccccgcttgcgatgga
cccacggcaccaagcagtcagaatggatggaatataaagcggcaagactgggatgtctgt
cacccaaaatacgattcacagccaataaaggctatggggaaagttccatctgctgtcaaa
cccgttgttccccaaaccttattgatgttttcagcacagtcaaacctggaggtaaaagaa
aacaagtttcttcggaatggctctcgcatatcactgaagaaggaatggcttggtggtaca
tggacgacggttccctctctatttccgaatctgggagtccatcaattcagttacacacag
agggctttttcccggaagaaaatcaacttattgctgaatggcttaccgatagaggatatc
ccaccagtgcaaaatcctatcgcagaagcattaacagcaaaacctattactacacaaaaa
tgggagcagtggccacccgcaagtggttatcggacttggaaatctattccatccccgcaa
tggcatacaaatttcgaggaagttgagtccgtcactaagggtcaagtggaaaaagtttat
gacctggaggtggaagataatcacaattttgttgccaatggcttactagtccataactgt
catatgttgagcacggccgcattcaatgccctgctaaaaaccttggaagagccaccggag
cgggttgtttttgtcctcgctaccaccgatccccagcgggttttacccaccattatttcc
cggtgtcagcggtttgattatcgccgcattcctttgcaggccatggtggaccatctccgt
tatattgctgggcgagaaaatattaatattgaccaaccagctttgaccctagtggcccaa
attgccaatggtggtttacgggatgcggaaagtttactcgatcaattaagtctgctcccc
gacctgattacccccgataaagtttgggacctcgtgggggcggtgccggaacaggatttg
ttagccctcctagaggcgatcgccagtgacgatgcagaaaccctattggctacctgtcgg
cagattttgaaccgggggcgggaacccttggtggtattgcaaaatttagccagtttttat
ttgaatttacttattgcccaaacagctccccaacgctcagatttggtggcggtgacggcg
gaaacctggcaagccctgtgtgacacggcgccccaatggcaaaggggagtgattttgcaa
ggacaacaaaaacttaaggaaagtgaaatccaaattcgtaacactacccagccccgactt
tggctagaggtgaccctgttggggctgttgccatccgcctgtgggttggacactggggca
gttagtcaaacggcagttagaacacctgtggctcaaccaataactccgccaaagcccagt
aatgtggtgactttccctggtggctcacacaaccatctaaccgtggtggattctcctaca
atgattcctgtttctgaacctattgttctagaagagaagctagaagcagatgtagagcca
tccagctttgagccgagcaacgcccattgggatctgacccagttatggtcggaaacgtta
aacaatctaggggcgctcagtcaatctttatttaaatcctttggttctttgatcaatttg
gtggggaataatgccaccgtcagtgttaccacccaacaactgcttaaaattgcggcgggc
aaaaaggatgaattggaagcggccctagggcaagcctgtggccaatcggtgaaagtgaat
ttggtggtgggtaagccatcgaccccggaaactactccggttaacagcgctcctccccct
agccatagtaagccgccagcctttgctccagagccaagccctccccccaccgcagcggtt
aatgctaatccggctcccactgtgcctccttctcccccggcgatcgccaggggccccgct
acatcggaaataaaaccttccccccgacgggaatcaaataatttctctaatccttctcgg
cccaaaccaaaaccggctccagccatggaagagccgcctccgacagatattggtgacagt
gccacccgcaaggcgatcgagcagtttgccaaaaattttgacggggaaattgtggcatcc
gatgcggctcccaaacaggaatcggataatggcgatgatttatctacggaaccaacggcg
gaacttggtcagcaacccatggatcacaatggacatctgcaaattaaccaacccaccgtc
ctgaaccgaccggcgatcgccccggaggaagaagaagatctacctttttag

DBGET integrated database retrieval system