KEGG   Synechocystis sp. PCC 6803: sll1451
Entry
sll1451           CDS       T00004                                 

Gene name
nrtB
Definition
(GenBank) nitrate transport protein; NrtB
  KO
K15577  nitrate/nitrite transport system permease protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00910  Nitrogen metabolism
syn02010  ABC transporters
Module
syn_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    sll1451 (nrtB)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    sll1451 (nrtB)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll1451 (nrtB)
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter
    sll1451 (nrtB)
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: BAA17491
CyanoBase: sll1451
CYORF: sll1451
UniProt: P73451
Position
complement(1008321..1009148)
AA seq 275 aa
MASSTAGLRPRRKKNPLSFIYSPKVIRPAVAIAVLLVVWQILCSGEGSNLPSPVQVLEQT
YPLILNPFFDNGGTDKGLGIQIFASLTRVAVGFSAAAVVGIALGILIGSSKFMYDALDPI
FQVLRTIPPLAWLPIALAALQEAEPSAIFVIFITAIWPIVINTTVGAQQVPQDYRNVSRV
LKLSKSQYFFNILFPAAVPYIFTGLRIGIGLSWLAIVAAEMLIGGVGIGFFIWDAYNSSL
ISEIIIALIYVGIVGLLLDRFIAFLESLVVPAEQK
NT seq 828 nt   +upstreamnt  +downstreamnt
atggctagttccaccgctgggctccgtccccgccgcaagaaaaatcccctcagtttcatt
tacagtcccaaggttattcgtcccgccgtggcgatcgccgttttgttggtggtttggcag
attctctgctccggagaaggttctaatctgcccagtcccgtgcaggtcttagaacaaacc
tatcctttaattctcaatcccttttttgacaatggtggcacagacaagggtttaggcatc
caaatttttgccagtttaaccagggtggcagtgggcttcagtgcggcggcggtggtgggc
attgccctaggcatcttaattggtagtagcaaatttatgtatgatgccctcgatccaatt
tttcaggttctaagaaccattcctcccttggcctggttgcccattgctctggcggctttg
caggaagcagagccttcggccattttcgttattttcattacggcaatttggcccatcgtc
atcaacaccacggtgggagctcaacaggttccccaggattatcggaatgtttcccgggtt
ctaaaactctccaaaagccaatactttttcaatattctattcccggcagcagtgccctac
attttcactggcctacgcattggcattggtctttcctggttggcgatcgtggcagcggaa
atgctgattggtggtgtgggcattggcttttttatctgggatgcctataacagctccctg
atcagtgaaatcattattgccttaatttatgtgggcattgtcggtttattgctagatcgt
tttatcgcttttctggaaagtttagtggtcccagcggagcaaaagtga

DBGET integrated database retrieval system