KEGG   Synechocystis sp. PCC 6803: sll1452
Entry
sll1452           CDS       T00004                                 

Gene name
nrtC
Definition
(GenBank) nitrate transport protein; NrtC
  KO
K15578  nitrate/nitrite transport system ATP-binding protein [EC:3.6.3.-]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00910  Nitrogen metabolism
syn02010  ABC transporters
Module
syn_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    sll1452 (nrtC)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    sll1452 (nrtC)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll1452 (nrtC)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.3  Catalysing transmembrane movement of substances
    3.6.3.-  
     sll1452 (nrtC)
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter
    sll1452 (nrtC)
SSDB
Motif
Pfam: NMT1_2 ABC_tran AAA_21 NMT1 RsgA_GTPase AAA_33 AAA_16 AAA_22 AAA_29 ABC_ATPase MMR_HSR1 AAA_15 FeoB_N
Other DBs
NCBI-ProteinID: BAA17490
CyanoBase: sll1452
CYORF: sll1452
UniProt: P73450
Position
complement(1006234..1008246)
AA seq 670 aa
MMPFIEIDHVDRIFPLPDGGRYIALKNIELKISQGEFISLIGHSGCGKSTLLNMISGLDK
PTFGGVIMEGKEITEPGPERMVVFQNYSLLPWLTVRQNIALAVNRVLRDLPKPEQEKIID
DNIALVGLQRAAHKRPGELSGGMKQRVAIARALSTRPKVLLLDEPFGALDALTRGNLQER
LMEIVQESGVTCIMVTHDVDEALLLSDRVVMLTTGPEAHIGQILEVPIPRPRHRLEVVNH
PSYYALRGEMVYFLNQQKRAKKVGAVSQFAEAMGGNGLEKINLDLGFIPLTDCAPLVVAK
EKGFFQKHGLEQVNLVKEPSWQAIADGIRERRLDGAQMVAGMPLALTLGMGGKTPLPMVT
AMVMSRNGNAITLSKKFAEAGVKTLEDLRLKLAETPDQVSTLGMVHPASMQNLLLRYWLA
SGSIDPDQDINLMRLPPPQMVSNLEAGNIDGFCVGEPWNSYAVKQNLGYVIATDLDIWNG
HPEKVLGMREEWVNKYPATHLALVKALLEACEYCDDRRHRQEILDYLALPQYVGTSTEYI
SPGFLTEYDQGNDAEAEMLLDFNQFYVKQSNYPSRSEGLWILTQLARWGYIDFPKNWVEI
IERVRRPDLFGEACRHLGWPDLEGDHHNVSLFDGMVFTPNDPLGYIKRFTIHRDIQVTEI
LIDQIDQVNQ
NT seq 2013 nt   +upstreamnt  +downstreamnt
atgatgcccttcattgaaattgatcatgttgaccgtatttttcccctccccgacgggggg
cgttacattgccctcaaaaacattgagctgaaaattagtcagggagaatttatttccttg
attggtcactctggctgcggcaagtctaccttgttgaacatgatctctgggctagataag
cccacctttggcggggtcatcatggaggggaaagaaatcaccgagcctggccctgaaagg
atggtggtgtttcaaaactactccctgttgccttggttgacggtgcgacaaaatatcgcc
ctggctgtgaatcgagttctgcgggatctgcccaaaccagaacaagaaaaaattattgac
gacaatattgccctggtggggttacaacgggcagcccataaacgaccgggggaattgtcc
gggggcatgaaacagcgggtggcgatcgccagggcattatcgacccgtcctaaggtttta
ttattggatgaaccgtttggggctttggatgctttaacccgggggaatctccaggaacgg
ttaatggaaattgtccaagaaagtggcgtaacctgcattatggtcacccatgatgtggac
gaagcattgttactttctgaccgggtggtgatgttaaccacagggcccgaagcccacatt
gggcaaattttggaagtgcccattcctcgaccccgtcaccgtttggaagtggtcaaccat
cccagttactacgccctgcggggggaaatggtttatttcctcaatcaacaaaaacgggct
aaaaaagttggggcggtcagtcagtttgccgaggccatggggggcaatggcctggaaaaa
atcaatctggacttaggttttatccccctcaccgattgcgccccgttagtggtagccaaa
gagaaaggtttcttccaaaagcatggtttagagcaagttaacctggtgaaagaacccagt
tggcaggcgatcgccgacggcattcgggaaagacggttagacggagcccaaatggtagcg
ggtatgcccctagctctaaccctaggcatgggggggaaaacccctttacccatggttacg
gccatggtgatgagtcgcaacggcaatgccattaccctcagcaaaaagtttgctgaagcg
ggggttaaaaccctcgaagatttacggttaaagctagcagaaactcccgatcaagtttcc
accctgggcatggttcaccccgcatctatgcaaaatctgttactgcggtattggcttgct
tctggcagtattgatccagaccaagatattaatttaatgcgcctaccaccgccccaaatg
gtgtctaatttagaagctggcaatattgacggtttttgtgtgggggaaccatggaattcc
tatgctgttaaacagaatttaggctatgttattgccacggatttagacatttggaacggt
catccggaaaaggttttaggaatgcgggaagaatgggtcaataaatatccagccacccat
ttagccctggttaaagctctgttggaagcctgtgaatattgtgacgatcgccgtcatcgc
caagaaattctagactatttggcattgcctcaatatgtcggcacctccacggaatatatc
agtccaggctttttgactgaatatgatcaaggaaatgacgcagaagcggaaatgttgctg
gacttcaatcaattttatgtcaagcaatctaactatccctcccgcagtgaagggttatgg
attctgacccaattagcccgttggggttacattgattttcctaaaaactgggtggaaatt
attgaacgggtacgccgtcctgacctatttggggaagcctgtcgccatttagggtggcca
gatttagaaggtgatcaccacaatgtttccctgtttgatggcatggttttcaccccgaat
gatccccttggttacattaaacgtttcaccattcaccgggatattcaagtcacagaaatt
ctcatcgaccaaattgatcaagttaatcaatag

DBGET integrated database retrieval system