KEGG   Synechocystis sp. PCC 6803: sll1453
Entry
sll1453           CDS       T00004                                 

Gene name
nrtD
Definition
(GenBank) nitrate transport protein; NrtD
  KO
K15579  nitrate/nitrite transport system ATP-binding protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00910  Nitrogen metabolism
syn02010  ABC transporters
Module
syn_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    sll1453 (nrtD)
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    sll1453 (nrtD)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll1453 (nrtD)
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Nitrate/nitrite transporter
    sll1453 (nrtD)
SSDB
Motif
Pfam: ABC_tran AAA_22 RsgA_GTPase SMC_N AAA_29 MMR_HSR1 AAA_16 AAA AAA_33 AAA_23 ATP-synt_ab FeoB_N Dynamin_N RNA_helicase Rad17 PduV-EutP AAA_28 NACHT AAA_15
Other DBs
NCBI-ProteinID: BAA17489
CyanoBase: sll1453
CYORF: sll1453
UniProt: P73449
Position
complement(1005181..1006179)
AA seq 332 aa
MQTMNVNDPILTEEKTAFLAIENVSKVYPTAQGPYTVLDGVNLEVKEGEFICIIGHSGCG
KSTLLNMVSGFNQPTQGTVKLKNQLITAPGPDRMMVFQNYCLLPWKSAYDNVSLAVESVY
PDKSKTEKEELVAHYLEMVGLTEAAQKKPGQISGGMKQRVAIARALAISPEVLILDEPFG
ALDAITKEELQEELLKIWRENNLTVLMITHDIDEALFLADRLVMMTNGPSAKIGEILDIP
FDRPRNRSQITDDPKYYQLRNYALDFLFHRYAHDDDDDLKEDKPNPGLLFKKVMAGALGL
VAIALVGVGLVQTFGSKGDGGPTPSVESMEGS
NT seq 999 nt   +upstreamnt  +downstreamnt
atgcaaacaatgaatgtcaatgaccctatcctgaccgaagaaaaaaccgcttttttagcc
attgaaaatgtcagtaaagtttatcccactgcccaggggccctatacggttttagatggg
gttaacttagaggtaaaagaaggggaatttatttgcatcattggccattccggttgcggt
aaatctaccctcttaaatatggtgtcgggctttaatcaacccacccaaggcacggttaag
ctgaaaaatcagttaattactgccccgggccctgaccgaatgatggttttccaaaattat
tgcctactgccttggaaatctgcctatgataatgtttccctggcggtggaatcggtttac
ccagataaatctaaaacggaaaaagaagaattggtagcccattacctcgaaatggtgggt
ttaacggaagcggctcagaaaaaacctgggcaaatttccgggggtatgaaacaacgggtg
gcgatcgccagagccttagctatttccccagaagtgttaattttagatgaaccttttggg
gctttggatgccattactaaggaggaattgcaggaagagttattaaaaatttggcgggaa
aataatctgaccgtgttgatgattacccacgacattgacgaagctttattcctcgccgat
cgcctagtgatgatgaccaatggccccagcgccaaaattggtgaaattttagatattccc
tttgaccgtccccgcaaccgcagtcaaattaccgatgatccaaaatattatcaactgcgg
aattatgcccttgattttctctttcaccgttatgcccatgacgatgatgatgacctcaaa
gaagataaacccaatcccggtttgctattcaaaaaagttatggcgggagccctaggacta
gtggcgatcgccttagtcggggttggtttggtgcaaacttttggttctaagggtgatggt
ggccctaccccctcagtggaatccatggaagggtcttga

DBGET integrated database retrieval system