KEGG   Synechocystis sp. PCC 6803: sll1454
Entry
sll1454           CDS       T00004                                 

Gene name
narB
Definition
(GenBank) nitrate reductase
  KO
K00367  ferredoxin-nitrate reductase [EC:1.7.7.2]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00910  Nitrogen metabolism
syn01100  Metabolic pathways
syn01120  Microbial metabolism in diverse environments
Module
syn_M00531  Assimilatory nitrate reduction, nitrate => ammonia
syn_M00615  Nitrate assimilation
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09102 Energy metabolism
   00910 Nitrogen metabolism
    sll1454 (narB)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.7  Acting on other nitrogenous compounds as donors
   1.7.7  With an iron-sulfur protein as acceptor
    1.7.7.2  ferredoxin---nitrate reductase
     sll1454 (narB)
SSDB
Motif
Pfam: Molybdopterin Molydop_binding Molybdop_Fe4S4
Other DBs
NCBI-ProteinID: BAA17488
CyanoBase: sll1454
CYORF: sll1454
UniProt: P73448
Position
complement(1002633..1004777)
AA seq 714 aa
MDSPAILPTTRTLCPYCGVGCGLEAVASPQKSVVDAGHAHKIRGDRQHPSSQGMVCVKGA
TVMESMDKQRLLYPMFRSSLDQPWQQISWEAALEIVVDKIQQVKQTLGVSGLCMYASGQM
QTEDYYVAQKLFKGCLGTNNFDTNSRLCMSSAVSAYSLSFGSDGPPCCYEDLEITDCAFL
IGTNTADCHPIIFNRLRKHHKQNPHVKLIVVDPRCTATAEVADLHLAINPGSDITLLHGI
AYLLKKWNLIDQKFIDNHTQDFEQYCQVIDHYPPEKVTQICGISLEQLETAAHYWGNAKT
VLSLWSMGMNQSFQGTAKGRCLINLHLLTGQIGKPGSGPFSLTGQPNAMGGREAGGLSHL
LPGYRSIKNPQHRQEVEQLWQISPGRINPEPGLSAWEMFMGLENQQVGFLWIVATNPVVS
MPDLERVKKALQQSTFTIHQDAYSPTETAEYAHLLLPAAQWSEKTGTMTNSERRVTLSPA
FRSPPGEARPDWEIFAEVGRRLGFENQFNFVDSAAVHREYVQLTAERLCDQSGVSYEKLQ
KLGPLQWPCRQSDQESQLLSTKRLYTDYKFCTENGRANFCLDHSRGLAEPVDPNYPFVLT
NGRLYGHWHTQTRTGHIEKIKKMHPKPILEMHPKDAEKLGIKSQDLVAIKSRRGSAQLEV
LVTRAIAPGTVFMPMHWGFLWDDNAEVNSLTHATACPISKQPELKACAVNITPV
NT seq 2145 nt   +upstreamnt  +downstreamnt
atggattcaccagctattcttcccaccaccagaaccctttgtccttactgtggagttggt
tgtggtttggaggctgttgctagtccccaaaagtcggtagttgatgccggtcatgcccat
aaaattagaggcgatcgccagcatccttccagccaaggcatggtctgcgtcaaaggagct
accgtaatggaatccatggataaacagcgattactttaccccatgtttcggtcaagttta
gatcagccgtggcaacaaattagttgggaagcagccctagaaattgttgttgataaaatt
cagcaagttaaacaaactttgggggtaagtggtttatgtatgtacgcctctgggcaaatg
cagacagaggattactacgtggcccaaaaattatttaaaggttgtttgggtaccaataat
tttgataccaattctcgtctttgcatgtcttcggctgtgtctgcctatagcctaagcttt
ggttccgatggtccgccttgctgttatgaagacttagaaataaccgattgcgctttttta
attggtactaatacagcggactgccatcccattatttttaatcgtttacgcaaacaccac
aaacaaaatccccacgttaaattaattgtggtggacccccgttgtactgccaccgcagaa
gttgcggacttacatttagcgatcaatcctggcagtgacattactttactccatggcatt
gcctatttgctaaaaaagtggaatttaattgatcaaaaatttattgataatcacacccaa
gattttgagcagtattgtcaagttattgatcattatcccccggaaaaagttacccaaatt
tgtggcattagtttagaacaattagaaaccgccgctcactattggggcaatgccaaaaca
gtgctttccctttggtccatgggaatgaatcaatcttttcaaggcacagctaaaggtcgt
tgtttaattaatctccatttactcactggtcagattgggaaaccaggcagtggacctttt
tccctcactggtcagcccaacgccatggggggtcgggaagcagggggattgtcccatctg
ttgcctggctatcgttcaattaaaaatcctcaacaccgccaagaggtagaacaactttgg
cagatttcccctggccgtattaatccagaaccaggtttatcagcctgggaaatgttcatg
ggattggaaaatcaacaggttggtttcctatggattgtggcgactaaccctgttgttagt
atgcctgatttagaaagggttaaaaaggctctgcaacaatcaacttttacgattcatcag
gatgcctattcccccactgaaacggcagaatacgcccatttgttattgccagcagctcaa
tggagcgaaaaaactggcacaatgaccaattcagaacggagagttaccctttctcctgcg
tttcgctctcctcctggggaagcaagacccgactgggaaatttttgctgaggtaggacgt
agattaggttttgaaaatcaatttaattttgttgattcagccgcagtacatcgggaatat
gtgcaactaactgctgaaagattatgtgaccaatctggtgtcagttatgaaaagttgcaa
aagctggggccgctgcaatggccctgtcgtcaatcagatcaagaaagtcaacttttatca
actaaaagactttacaccgactataaattttgcacagaaaatggtcgggcaaacttttgc
ttagaccacagtcggggattagctgagccggtcgatccaaactatccttttgtcctcacc
aatggtcgtctttatggtcattggcatacccaaacccgcactggccacattgagaaaatc
aaaaaaatgcatcccaaacctatattggaaatgcatcccaaggacgcagaaaaattgggt
attaaaagtcaggatttagttgcgattaaatctcgacggggttctgctcagctagaagtt
ctagttactagagccattgcccccggtacggtttttatgcccatgcactggggttttttg
tgggacgataatgctgaagttaatagtttgacccatgccactgcttgccctatttctaaa
caaccggaattaaaagcctgcgccgttaatattacaccagtttaa

DBGET integrated database retrieval system