KEGG   Synechocystis sp. PCC 6803: sll1455
Entry
sll1455           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Nitr_red_assoc
Other DBs
NCBI-ProteinID: BAA17487
CyanoBase: sll1455
CYORF: sll1455
UniProt: P73447
Position
complement(1001639..1002106)
AA seq 155 aa
MFFQFEADFVDSLRCIPMVVRYKLDTCGVKLKLSHWHQLSLEQRQYLTEASCETPTEVSQ
YGEKLQNWITELTGKPASTLSVPDLPDWLNANQIPAQILTELNNKLPSLESSGITLTQWQ
SLTPLQRFALIKLSRAGHENRNFLLAIKEFDLMPS
NT seq 468 nt   +upstreamnt  +downstreamnt
atgttttttcaatttgaagctgattttgttgattccctccgctgtattcccatggttgtg
cgttataaactagacacctgtggcgttaaattaaaattaagtcattggcatcaactgagt
ttggaacaaaggcagtatttgactgaagctagttgtgaaacaccaacagaagttagccaa
tatggggaaaagctgcaaaattggataacggaattaactggcaagccagcttccacatta
tcagtgccggatttacccgattggttaaatgccaatcaaattccagctcaaatattaacg
gagttaaataataaattaccgtctttggaatcttccggcattacgttgactcaatggcaa
tccctgactcctttgcaaagatttgctttaattaaactaagtcgtgctggccacgaaaat
cgtaattttctgctggccatcaaagaatttgatctgatgccaagctga

DBGET integrated database retrieval system