KEGG   Synechocystis sp. PCC 6803: sll1456
Entry
sll1456           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Methyltransf_21 V_cholerae_RfbT PCMT Fibrillarin PrmA MTS Methyltr_RsmB-F Methyltransf_31 Met_10
Other DBs
NCBI-ProteinID: BAA17485
CyanoBase: sll1456
CYORF: sll1456
UniProt: P73445
Position
complement(998010..998918)
AA seq 302 aa
MQKFFKQLRRKLFGLDEQEAAMLRAIADTNDLIAGLQKSFDHLHLDYSRALVEIVAQSQP
QTTLSCEINGVPLRVPVGILRAYAHCLETSQEFSFTYCIESHCVQWLGQHLRPGDVFFDV
GAAYGVISIPLAEIVGNNGHIYAFEPARQTRQSLEQIVKGNHLENITVLPLAIADETGEA
EFIEYSTDNRFSWAADTSTLAKDVEPSLDNYATYAVEITTIDKFAGENNLSPKAIKIDIE
GFELYALQGAMETLKTCRPYLCIDIHADVKTKQSALLGVQPLLEGLGYRCNSDGHTLFAS
PV
NT seq 909 nt   +upstreamnt  +downstreamnt
atgcaaaaattttttaaacaattacgtcgcaagctttttggcctagatgagcaggaagca
gccatgctcagggcgatcgccgacaccaatgatttgattgctggtttacaaaaatccttt
gatcatctccatttggattacagccgggctttagtggaaattgttgcccagagccaaccc
cagactaccctaagctgtgaaattaatggggttcccctcagagttccggtgggaatttta
cgggcctatgcccattgcttggaaacgtcccaggaatttagttttacctattgcatagaa
agccattgcgttcagtggctggggcagcatctacggcccggggacgtgttttttgatgtg
ggggcggcctacggggtgattagtattcccttggcagaaattgttggtaataacggccat
atctatgcctttgagcccgctcgccaaacccgtcaaagccttgaacaaatcgttaagggc
aaccacctggaaaatattacagttcttcccctggcgatcgccgatgaaacgggggaagcg
gaattcattgaatatagtactgataaccgtttttcctgggcggcggacacttctaccttg
gcgaaagatgtggagcctagcctagataattatgctacctacgcagtggaaatcaccacc
attgataaatttgccggggaaaacaatctcagccccaaagcgatcaaaattgatattgaa
ggttttgaactgtatgctctccagggggccatggaaacattaaaaacctgtcgcccctat
ctttgcattgacatccacgctgatgtgaaaaccaaacaatcggcattgttgggagtccaa
ccgttgttagagggattgggttaccgttgcaacagcgatggccatactctgtttgctagt
cctgtgtga

DBGET integrated database retrieval system