KEGG   Synechocystis sp. PCC 6803: sll1457
Entry
sll1457           CDS       T00004                                 

Gene name
rfbJ
Definition
(GenBank) RfbJ protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_3 Glyco_tranf_2_4 ThiC-associated
Other DBs
NCBI-ProteinID: BAA17484
CyanoBase: sll1457
CYORF: sll1457
UniProt: P73444
Position
complement(996850..997806)
AA seq 318 aa
MSTSFSSAYRLAVLVPCRNEALTITQVVTDFRQQLPNAAIYVYDNCSTDDTATVAQQAGA
IVRYEKQPGKGNVIRRMFADIEADIYILVDGDNTYEAEAVGRLIDRLINEQLDMVVGARR
SEVKDKEAYRFGHRSGNQLLKGIVELQFGARLDDMLSGYRIFSRRFVKCFPAISNGFEIE
TELTIHTLELRLPFAEEPVLYQSRPSGSESKLNTISDGFRVLGTSFLLMKETRPFLFFGV
FFALFSGSAIALMLPVVFTYLETGLVPRFPTVIIAASLMSLGFVFFTCGLILDSVARGRR
ELKRMAYLRIPRVEIKEV
NT seq 957 nt   +upstreamnt  +downstreamnt
gtgtcaacctctttttccagtgcctatcgtttggcggtgctagttccttgccgtaatgaa
gctttgaccatcacccaggttgtgactgattttcgccagcagttgcccaatgccgccatc
tacgtttacgacaattgttccaccgatgacaccgccaccgtcgcccagcaagcaggggcc
attgttcgttacgagaaacaaccgggtaaaggcaatgtgatccgccgcatgtttgctgat
attgaagcggatatttacattttggtggatggggacaatacctatgaagccgaagcggtg
ggtagattgattgatcgcctgattaatgagcaattggatatggtggtgggggctcggcga
tcggaggttaaggacaaggaggcctaccgttttggccaccgcagtggtaaccaactatta
aagggcattgtggaattacaatttggggctcggttggacgatatgttgtcgggctacaga
attttttcccgccgttttgttaaatgcttcccagctatttccaacggatttgaaattgaa
acggaattaactatccacaccctagaactacgtctgccctttgccgaagaaccagtgtta
taccaatctcgcccttctggctccgaaagtaagttaaacaccattagcgatggctttcgg
gttttgggtacctcctttttactgatgaaggaaacccgcccattcctcttttttggtgtg
ttctttgccctcttttccgggtcggcgatcgccttaatgttgccggtggtatttacctat
ctggaaacgggtctagtaccgagatttcccacagtcatcattgccgcttctttaatgtcc
ttgggctttgtctttttcacctgcggcctaattttagattccgttgcccggggaagacgg
gagcttaagcgcatggcttatctcagaattcccagggtcgaaattaaggaggtctag

DBGET integrated database retrieval system