KEGG   Synechocystis sp. PCC 6803: sll1464
Entry
sll1464           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K08997  serine/tyrosine/threonine adenylyltransferase [EC:2.7.7.-]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    sll1464
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.7  Nucleotidyltransferases
    2.7.7.-  
     sll1464
SSDB
Motif
Pfam: UPF0061
Other DBs
NCBI-ProteinID: BAA17476
CyanoBase: sll1464
CYORF: sll1464
UniProt: P73436
Position
complement(988072..989505)
AA seq 477 aa
MTNPFLNLTYEPALESLGNEFFDPVSAATFPEHKLRFRNDRLLPMLGLEPSQVKDDNFVE
AFGLFHGVRPFLALRYHGYQFGEYNPNLGDGRGFLYGQVRGVNGELFDFGTKGSGQTPYS
RGGDGRLTLKGGVREVLAAEALHRLGVKTSRCLSLVETGDSLWRGDEPSPTRASVMIRFS
RSHIRFGTFERLHYHHQTEQIAQLLDHVIVTYYPEVSGSNSDDSAHIAFFRVLVERVAKL
VAQWMAAGFCHGVLNTDNMSITGESFDYGPYGFVPTYDLNFIAAYFDYGGRYRFGNQPAV
CRWNLERLQVSLSSVIPSKAMTEALEDYEKIYLGYYITLIARRLGISSTLGDRLDPELWE
KLVGQTLQCLAQSQWSYPDFFAQLRLNFSPSWRDNADLILENVDLLGADWSTWRSIYQQV
LKQLPPESLAAVPTVLEQANPLTDLLRPRIETVWQAIAEDDNWQPFNDLVQKLQSGN
NT seq 1434 nt   +upstreamnt  +downstreamnt
gtgactaatccctttctgaatttgacctacgaacctgctttagaatccttgggcaatgaa
ttttttgacccagtgtcagcagcgacttttcctgagcataaactgagattccgtaacgat
cgcctgttgcccatgttgggtctggagccaagtcaggttaaggatgataatttcgttgaa
gctttcggtttattccatggggtaaggccatttttagctctgcgttaccacggttaccaa
ttcggtgaatataatcctaatttgggtgacggtcggggttttctctacggccaagtgcgg
ggagtaaacggggaattattcgattttggcaccaaaggctctggccagactccctattcc
cggggcggtgatggccgcctaaccctcaaaggtggggtaagggaagtgttggccgctgag
gcgttgcatcgtttgggggtaaaaacttctcgttgtctgagtttagtggaaacgggggat
tccttgtggcggggggatgagccttcccctactagggcgtcggtaatgatccgctttagc
cgttcccacattcgttttggtacttttgagcgactccattaccatcaccaaacggaacag
attgcacaactactggatcacgtaattgtaacctactatccagaggtttctggctccaac
tccgatgattcagcccatattgcttttttccgagttttggtggagcgggtggccaagttg
gtggcccaatggatggcggcgggattttgccatggggttttaaacacggacaatatgtcc
atcaccggggaaagctttgattacggcccctatggttttgtgcccacctacgatttaaat
tttattgccgcctattttgactatggtggtcgctaccgctttggtaatcaacccgctgtc
tgtcgctggaatttggaacgcctacaagtatccctaagttccgtcattcccagcaaagcg
atgacagaggcattggaagactacgaaaaaatttatttaggctactacatcaccttaata
gcccgccgccttggtatttcctccacccttggcgatcgcctagacccggagttatgggaa
aaattagtgggtcagaccctgcaatgtttagcccaaagccaatggagttacccggacttt
tttgcccaattgcggcttaatttcagccctagttggcgagacaatgccgatttgattttg
gaaaatgtcgatttactaggggcagattggtcaacttggcgatcgatataccaacaggtg
ttaaagcaattgcctccggaatccttggcggcagtgcccactgtgcttgagcaagccaac
ccccttaccgatctactccggccccgcattgaaaccgtttggcaggcgatcgccgaagat
gataattggcaaccatttaacgatttggtgcagaaactacaaagcgggaattaa

DBGET integrated database retrieval system