KEGG   Synechocystis sp. PCC 6803: sll1466
Entry
sll1466           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Glyco_trans_4_3 Glycos_transf_1 Glyco_trans_1_4 Glyco_trans_1_2 Glyco_transf_4 Glyco_trans_4_4
Other DBs
NCBI-ProteinID: BAA17474
CyanoBase: sll1466
CYORF: sll1466
UniProt: P73434
Position
complement(986492..987733)
AA seq 413 aa
MNVLFLHQNFPGQFKHLAPALVAQGHQVVAMIMQKNASPQWQGVKLINYFPNRGSTPNIH
PWLVDFETKTIRAESVFHQARKLKAQGFNPDVVIANPGWGESLFVKDVWPETKLGIYCEF
FYHASGYDTTFDPEFANVDETEVCRIRWKNINHYLHFDIADGGLAPTQWQADSFPEPFRS
KLTVVHDGIDTDILRPNADANLTFNNQITLNRSDEIITFVNRNLEPYRGYHSFMRSLPEI
LTNRPHAKVLIVGGNGVSYGAKPPGDRPWRDIFLDEVKPKLTPEQLSRLYFLGTIPYNYF
INLLQISTVHVYLSYPFVLSWSLLESMACGCAIAASNTAPVREVITDGETGRLVDFFDYS
AIATTICQLLEDKEERQRLGINARRLVQAKYDLQTICLPQQLQWLENLVSPQH
NT seq 1242 nt   +upstreamnt  +downstreamnt
atgaacgttctctttcttcaccaaaattttcctgggcaatttaaacacctcgcccctgct
ttggtagcccaagggcatcaggtggtggccatgatcatgcaaaaaaatgcatctccccaa
tggcaaggggtaaagttgatcaactattttcccaatcggggcagtaccccaaacattcac
ccttggttggtggactttgaaactaaaaccatccgggcagaatccgtttttcatcaagcc
cgaaagttaaaagcccaaggatttaatcccgacgttgttattgctaaccctggttggggc
gaaagtttatttgtcaaagatgtgtggccagaaacgaaattgggcatttactgcgaattt
ttctaccatgcgtccggctatgacaccacctttgatccggaatttgccaacgttgacgaa
acagaggtctgtcgcattcgctggaaaaatatcaaccattatctccattttgacattgcc
gacggtggcctggcgcctacccaatggcaagcggattcctttcccgaacctttccgctcc
aagctgacagttgtccacgacggcattgacaccgatattctgcgtcccaacgccgatgcc
aacttaacttttaataatcaaatcaccctcaaccgcagcgacgagatcattacctttgtc
aatcgcaacctggaaccctaccggggctaccacagttttatgcgttccctgccggaaatt
ctcactaatcgtccccatgccaaggttttaattgtgggcggcaatggggtgagttatgga
gccaagcccccaggcgatcgcccttggcgggacatttttctcgacgaggttaaaccaaaa
ctaacgccagaacagttaagtcgtctgtattttctcggcaccattccctacaactatttc
attaatctgctacaaatctccactgtccacgtttacctcagttatccctttgtgctgtcc
tggagcttactggaatccatggcctgtggctgtgcgatcgccgctagtaatacagcccca
gtgcgggaggtgatcaccgatggcgaaacgggacggttagtggacttcttcgactactca
gccatcgccacaactatctgccagttattagaagacaaagaggagagacaaaggctagga
atcaacgcccgccgcctagtccaggctaaatatgacctacagaccatctgcctaccccaa
caattacagtggctagagaatctggtttctccccagcattaa

DBGET integrated database retrieval system