KEGG   Synechocystis sp. PCC 6803: sll1599
Entry
sll1599           CDS       T00004                                 

Symbol
mntA
Name
(GenBank) Mn transporter; MntA
  KO
K11603  manganese transport system ATP-binding protein [EC:7.2.2.5]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02010  ABC transporters
syn02020  Two-component system
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    sll1599 (mntA)
  09132 Signal transduction
   02020 Two-component system
    sll1599 (mntA)
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll1599 (mntA)
Enzymes [BR:syn01000]
 7. Translocases
  7.2  Catalysing the translocation of inorganic cations
   7.2.2  Linked to the hydrolysis of a nucleoside triphosphate
    7.2.2.5  ABC-type Mn2+ transporter
     sll1599 (mntA)
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Metallic cation, iron-siderophore and vitamin B12 transporters
   Manganese transporter
    sll1599 (mntA)
SSDB
Motif
Pfam: ABC_tran AAA_21 SMC_N AAA_29 AAA_15 AAA_23 SbcC_Walker_B AAA_16 AAA_7 AAA_30 NTPase_1 Zot AAA_22 ATPase_2 AAA_33 RsgA_GTPase NB-ARC AAA MukB MMR_HSR1 NACHT DUF3987 Stb3 DUF5906 TsaE AAA_18
Other DBs
NCBI-ProteinID: BAA17918
CyanoBase: sll1599
CYORF: sll1599
UniProt: Q55281
Position
complement(1481380..1482162)
AA seq 260 aa
MAATLSRLDISVDGVSVTYNNARLALYNATCTVEPGTITALVGPNGSGKSTLFKSIMGFL
QPSQGRVRIGGFSVQKAQKQQLMAYVPQADEVDWNFPVSVFDVVMMGRYGYMNVLRIPSA
KDRRLVMESLERVGMVKYRDRQIGELSGGQKKRAFLARALAQEGKVILLDEPFTGVDVKT
EKGMIDLLMELRDEGHTILISTHDLASISTFCDHTILLNRTILAQGKTEETFTKENLELT
FGGLPMLSLNQMFESTEVDA
NT seq 783 nt   +upstreamnt  +downstreamnt
atggcagccaccctatctcgtcttgatatatccgtcgatggtgtcagcgttacctataac
aacgcccgtttggccctttataacgctacctgcaccgttgaacccggcaccattaccgcc
ctggtggggcccaatggcagtggtaaatcgactctgttcaaatccatcatggggtttttg
caaccgagtcagggacgggtacgcattggtggcttttccgtacaaaaggcccaaaagcaa
cagttgatggcctacgttccccaagctgatgaggtggactggaactttccggtcagtgtg
tttgatgtggtgatgatggggcgctatggctatatgaatgtgttgcgtattcctagcgcc
aaagaccgtcgtttggtgatggaaagtctagagcgggtgggcatggtgaaataccgcgat
cgccaaattggggaactttccggcggtcaaaagaagcgggcatttttggcccgggccttg
gcccaggaaggcaaggtaattctgttagatgagccttttaccggggttgatgtgaaaaca
gaaaaaggcatgattgatttactcatggaactgcgggatgaggggcacaccattctgatt
tctacccatgatttggcctccatttccaccttttgtgaccacaccattctgctcaaccgc
actattttggcccagggtaaaactgaagaaaccttcaccaaagaaaatttggaactgact
tttggtgggctaccaatgctgagtctgaatcagatgtttgaatcgacagaggtagatgcg
tga

DBGET integrated database retrieval system