KEGG   Synechocystis sp. PCC 6803: sll1614
Entry
sll1614           CDS       T00004                                 

Gene name
pma1
Definition
(GenBank) cation-transporting ATPase; E1-E2 ATPase
Organism
syn  Synechocystis sp. PCC 6803
Motif
Pfam: E1-E2_ATPase Cation_ATPase_C Hydrolase Cation_ATPase_N Cation_ATPase Hydrolase_3 HAD
Other DBs
NCBI-ProteinID: BAA17897
CyanoBase: sll1614
CYORF: sll1614
UniProt: P37367
Position
complement(1457213..1459930)
AA seq 905 aa
MDFPTLSSYLHHHRPGEDILADLHTDPGLGLTAEAVAQRYEQYGRNELKFKPGKPAWLRF
LLQFHQPLLYILLIAGTVKAFLGSWTNAWVIWGVTLVNAIIGYIQEAKAEGAIASLAKAV
TTEATVLRDGQNLRIPSQDLVIGDIVSLASGDKVPADLRLLKVRNLQVDESALTGEAVPV
EKAVELLPEETPLAERLNMAYAGSFVTFGQGTGVVVATANATEMGQISQSMEKQVSLMTP
LTRKFAKFSHTLLYVIVTLAAFTFAVGWGRGGSPLEMFEAAVALAVSAIPEGLPAVVTVT
LAIGVNRMAKRNAIIRKLPAVEALGSATVVCSDKTGTLTENQMTVQAVYAGGKHYEVSGG
GYSPKGEFWQVMGEEVDNVLLDGLPPVLEECLLTGMLCNDSQLEHRGDDWAVVGDPTEGA
LLASAAKAGFSQAGLASQKPRLDSIPFESDYQYMATLHDGDGRTIYVKGSVESLLQRCES
MLLDDGQMVSIDRGEIEENVEDMAQQGLRVLAFAKKTVEPHHHAIDHGDIETGLIFLGLQ
GMIDPPRPEAIAAVHACHDAGIEVKMITGDHISTAQAIAKRMGIAAEGDGIAFEGRQLAT
MGPAELAQAAEDSCVFARVAPAQKLQLVEALQEKGHIVAMTGDGVNDAPALKRADIGIAM
GKGGTEVARESSDMLLTDDNFASIEAAVEEGRTVYQNLRKAIAFLLPVNGGESMTILISV
LLALNLPILSLQVLWLNMINSITMTVPLAFEAKSPGIMQQAPRNPNEPLITKKLLHRILL
VSLFNWILIFGMFEWVNRTYDDLALARTMAIQALVAARVIYLLSISQLGRSFLGYVTGKR
QTITKASILLLGIAVAIALQIGFSQLPFMNVLFKTAPMDWQQWAICLLPMIPMVPVAILA
NRLDP
NT seq 2718 nt   +upstreamnt  +downstreamnt
atggatttccccaccttaagttcttacctccatcaccatcgaccaggggaagacattctt
gcagatttgcacaccgatccaggtttaggtctgacagcggaggcggtggcccagcgttac
gaacaatatggccgcaacgaattgaaatttaaaccgggcaaaccagcttggttgcgtttt
ctgctgcaatttcaccaacctctgctctacattctgctcattgctggtacggttaaggct
tttctcggctcctggaccaacgcctgggttatttggggagttaccctagtcaacgccatc
attggttacatccaagaagcgaaagcagaaggggcgatcgcctccttggccaaggcagta
acaacagaagccacagtgttgagagatgggcaaaatctacggattccttcccaggattta
gtcatcggtgacattgtttccctcgcttcgggggataaggtgccagcggatctaaggctg
ttaaaagtgcgtaatctccaggtggatgagtcggctttgacgggggaagcagtgccggtg
gaaaaggcggtggaacttttaccggaggaaacgcccctggccgaaaggttaaacatggcc
tatgcggggagctttgtcacctttggtcagggaaccggggtggtagtagctactgccaat
gccacggaaatggggcaaatttcccaatccatggaaaagcaggtcagcctcatgacccct
ttgacccgtaagtttgccaaatttagccacacactgctctacgtaattgttaccctggcg
gccttcacctttgcggtgggttggggacggggtggttcccctttggaaatgtttgaagcg
gcggtggccttggccgttagtgccattcccgaaggtttgcctgctgtggtgaccgtcacc
ttggcgatcggggtgaatcgcatggctaaacgtaacgccattatccgtaaactgcccgct
gtggaggcgttgggtagtgccacggtggtttgctccgataaaactgggaccctaacggag
aatcagatgacagtgcaagcggtgtatgcggggggcaaacattacgaagttagcggcggt
ggttacagtcccaaaggagaattttggcaagtgatgggagaagaagtggataacgttttg
ttggatggtttacccccagtgttggaagaatgtttgctgacgggcatgctctgtaacgat
tcccaactggaacatcggggggatgattgggcggtggtgggggatcccacggagggagca
ctgctagcttcggcggccaaggctggtttcagtcaagccggtttggcaagtcaaaaaccc
cgtttagattccattccctttgaatcggattatcaatacatggcaactctccacgatggg
gacggcagaacaatttacgtcaaaggttcagtggagtccttactacaacggtgtgaatcc
atgctcctcgatgatggtcaaatggttagcatcgaccgaggggaaattgaggaaaatgtt
gaggatatggcccaacagggtctaagagtgttggcctttgctaaaaaaaccgtggagccc
catcaccatgcgattgaccacggggatattgaaacagggctaatatttttaggtttacag
ggcatgatcgacccgccacgaccggaggccattgccgcagtccacgcctgccatgacgct
ggcattgaagtgaaaatgatcaccggcgaccacatcagcaccgctcaggcgatcgccaaa
cggatgggtattgccgctgaaggggatggcattgcttttgaaggacgacagttggcaacc
atgggtccggcagaattggcccaagccgctgaagatagttgcgtgtttgccagggtagct
ccagcacaaaaattacaactggtggaagctctacaggagaagggtcacattgtcgccatg
acgggggatggggtgaacgatgccccagctttaaaacgggctgacattggcattgccatg
ggtaaagggggcacagaggtggctagggaatcctccgatatgttgctcacggacgataat
tttgcctccattgaagcggcggtggaagaaggacgcaccgtttaccaaaatctccgtaag
gcgatcgcctttttgctgccggttaatggcggggagtccatgaccattttgatcagcgtt
ttactggcgttgaatttgcccattctttccctgcaggtgttgtggttaaacatgatcaac
tccatcaccatgactgtgcccctagcctttgaagccaaatcaccgggcattatgcaacag
gctccccgcaatcccaacgaacccctaattaccaaaaagttactgcaccgcattttactg
gtatccctgttcaattggattctaatttttggcatgttcgagtgggttaatcgcacctat
gacgacttagccctagctcgtactatggccatccaagccctggtggccgctagggtgatt
tatctactcagcattagccagttagggcgtagttttctgggctatgtgacgggtaaacgt
caaaccattaccaaagcctccatactgttactgggcattgcggtggcgatcgccttacaa
attggtttcagtcaactgccatttatgaatgtattgttcaaaactgctcccatggactgg
caacagtgggcaatctgtttactacctatgattcccatggtgcccgtggccattctggct
aaccgccttgatccttaa

DBGET integrated database retrieval system