KEGG   Synechocystis sp. PCC 6803: sll1709Help
Entry
sll1709           CDS       T00004                                 

Gene name
gdh
Definition
(GenBank) glucose dehydrogenase
  KO
K00034  glucose 1-dehydrogenase [EC:1.1.1.47]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00030  Pentose phosphate pathway
syn01100  Metabolic pathways
syn01120  Microbial metabolism in diverse environments
syn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    sll1709 (gdh)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.1  Acting on the CH-OH group of donors
   1.1.1  With NAD+ or NADP+ as acceptor
    1.1.1.47  glucose 1-dehydrogenase [NAD(P)+]
     sll1709 (gdh)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: adh_short_C2 adh_short KR Epimerase NAD_binding_7 THF_DHG_CYH_C
Motif
Other DBs
NCBI-ProteinID: BAA17730
CyanoBase: sll1709
CYORF: sll1709
UniProt: P73684
Position
complement(1276236..1276982)
Genome map
AA seq 248 aa AA seqDB search
MELTGKTALVTGGGIRVGRALVMALAEAGCNVFIHYGNSQTGALEVQQEVEALGRKAFTY
SADLSDAQATQGIIPKAQEVFGQVDILINSASVFPLEDKFFQVDLDLWEWIFAVNLRAPF
QLSQAFAQQVAGDRQGKIININDARIPRPRPDHFVYRLTKRGLWDMTEILALELAPNITV
NGLALGQILEAPEAPDPEEFMRDYAERRIPLKMTGNPKVVTDAALYLLQQDFLSGTTIRL
DGAEYLKF
NT seq 747 nt NT seq  +upstreamnt  +downstreamnt
atggaattaactggaaaaacagccctggtcaccgggggaggcataagggttggtcgggcc
ctagttatggccctggcggaagccggttgtaacgtctttattcactacggtaattcccag
accggagccctagaggttcagcaagaagtggaagcattgggtaggaaagcttttacctac
tccgccgatttgagcgatgcccaggccacccaaggaattattcccaaagcccaggaagtc
tttggccaggtggatattctgatcaacagtgcctcggtttttcccctagaagataaattc
tttcaagtggatctcgacctgtgggaatggatttttgccgttaatctccgggcccccttt
cagttgtcccaggcctttgctcaacaagtagccggcgatcgccaaggaaaaattattaac
attaacgatgcccgcattccccgaccaaggccagaccattttgtttaccgtcttaccaaa
cggggtttgtgggatatgacggaaattttagccctggaattggcccccaatatcaccgtt
aatggcctcgccctaggacagattttagaagctccggaagcgccggacccggaagagttt
atgcgggattatgcagagcgacgtattcctttaaaaatgaccggcaatcccaaagtagtc
actgatgcggccctatatttgctacaacaggattttctgagtggcaccaccattcgttta
gatggagcagaatatttgaagttttag

DBGET integrated database retrieval system