KEGG   Synechocystis sp. PCC 6803: sll1710
Entry
sll1710           CDS       T00004                                 

Definition
(GenBank) transposase
  KO
K07492  putative transposase
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09192 Unclassified: genetic information processing
   99976 Replication and repair
    sll1710
SSDB
Motif
Pfam: DUF4096 DDE_Tnp_1 DDE_Tnp_1_2
Other DBs
NCBI-ProteinID: BAA17729
CyanoBase: sll1710
CYORF: sll1710
UniProt: P73683
Position
complement(1275372..1276157)
AA seq 261 aa
MIIREFYSTDITDSQWQLVEPHLPKAKTGGRKRKTSLREILNAIFYMLRTGCAWRLLPHD
FPKWRTVYGYFQQWHEDGTWRKLNRIFREKVRLKAGRNTHPSAGCLDSQSLKKAGTGQET
GYDGGKKVNGRKRTILVDTMGLLLDVVVHGAHRSDHQGLILLATWFAPLWQCLQVIWTDS
TFGGKDFIYWVEHTFGWNLNVVSKKQGQKGFEVLPRRWVVERTFAWFGRYRRLSKDYEYL
PTTSETMIHVAMLHLMLQRLA
NT seq 786 nt   +upstreamnt  +downstreamnt
atgataattcgagaattttacagcacggacatcactgatagccagtggcaattggtagaa
ccccatttacccaaagcaaaaactgggggaagaaaacggaaaactagtctgcgggagata
ctcaatgccattttttacatgctcagaacggggtgtgcctggcgacttctaccccatgat
ttccctaaatggcgaacggtctatggttatttccagcaatggcacgaagatggtacctgg
agaaaattaaaccgtatcttccgtgagaaggttcgactcaaagctggaagaaatactcac
cctagtgctggttgtttagattcacagtcacttaaaaaggctggaactggccaagaaact
ggctatgacggcggaaaaaaggtcaatggtcgtaaacgtacaatcctcgtggataccatg
ggattacttctcgatgttgtcgtccatggtgcccatcgctccgaccatcagggtctgatt
ctacttgctacctggtttgctcccctttggcagtgcctgcaagttatatggactgacagc
acctttggcggaaaggattttatctattgggtggagcatacttttggttggaatttgaat
gtcgtcagcaaaaagcagggacaaaaaggttttgaagtcttaccccgccgttgggtagtc
gagcgcacctttgcttggtttggacgctatcgtcgtttaagcaaggattatgaatattta
cctaccaccagtgagacaatgattcatgttgccatgctccatctcatgcttcaaaggctt
gcttaa

DBGET integrated database retrieval system