KEGG   Synechocystis sp. PCC 6803: sll1713
Entry
sll1713           CDS       T00004                                 

Gene name
hisC
Definition
(GenBank) histidinol-phosphate aminotransferase
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Aminotran_1_2
Other DBs
NCBI-ProteinID: BAA17457
CyanoBase: sll1713
CYORF: sll1713
UniProt: P73417
Position
complement(969762..970820)
AA seq 352 aa
MAGCPAFSLLDFSASINPLGPPASVLAAIESALPALRHYPDPQYIHLRQAIADHHQLSMD
WVLPGNGSAELLTLAGRTFASLDCTYVVGPAFGDYGRSWRGAGAELKTIPWQVDQPWPWR
KLRSPSEIANTSAVQSSHHGLILNNPHNPSGTLLAREEILALLPHYQWVLLDEAFMDFLP
PGEEQSLVGDLEKHPNLIILRSLTKFYRLPGLRLGYALAHPDLLAQWQAWRDPWPVNVLA
EAAAIASLEAEEFRQLVWQWLPPARSALQQDLASLPGLFPLPSQTNFLLVKTTIPAPELQ
EELLTKCQILIRDCLSFPELGEDFFRVAVRTMADNQKLTQALATIMATAAPS
NT seq 1059 nt   +upstreamnt  +downstreamnt
atggcaggctgtccagctttttctttactagatttttccgccagtattaatcctttgggc
ccccccgcctctgtcctggccgccattgagtcagctttgccggccctgcgccactatccc
gacccccaatatattcatcttcgtcaggcgatcgccgatcatcatcagttgtcgatggat
tgggtgttgccgggcaacggttccgcggaattgttaaccctagcggggcgcacttttgct
agtttggattgtacctatgtggtgggcccggcctttggggactatggccgcagttggcgg
ggagccggagccgagcttaaaactattccctggcaggttgatcaaccatggccttggcga
aaattgcgatcgccatcggaaattgccaatacttcagccgtccagtcctcacaccacggt
ttaattctcaataatccccataatccctccggcactctactagctcgggaggaaattctt
gccctcctgccccactatcaatgggtgttgttggacgaagcttttatggattttctgccc
ccgggagaagagcaaagtctggtgggggatttggagaaacatcccaatttaattattctc
cgctctctgaccaagttttatcgtttgcccggattacgcttaggttatgccctagcccac
ccagatcttttagctcaatggcaagcttggcgggacccctggcctgtgaatgtgttggcc
gaagcggcggcgatcgccagtttggaagccgaggaatttcgtcaactggtttggcaatgg
ttaccccctgcccgtagcgcattgcagcaagatttagcgagtttaccagggctatttccc
ttgccgagtcagaccaattttttgctcgtaaaaacgaccatacctgctccagaacttcaa
gaagaactattaactaaatgccaaattttgatccgagattgtcttagttttcccgaatta
ggtgaggattttttccgagtggcagtgcggacaatggcagataaccaaaaattaacccag
gccctagctactattatggccacggccgcccctagctag

DBGET integrated database retrieval system