KEGG   Synechocystis sp. PCC 6803: sll1714Help
Entry
sll1714           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB OrthologParalogGene clusterGFIT
Other DBs
NCBI-ProteinID: BAA17456
CyanoBase: sll1714
CYORF: sll1714
UniProt: P73416
Position
complement(968893..969294)
Genome map
AA seq 133 aa AA seqDB search
MLRELRTNRASWKIFTGKKLRKQYLLSLISTQRSSLDNTKEGQAILKKVHSFYKMMLQEL
EAVFDGTALQLEVPLNLAAGTRVRIVVESVLPNEVKAPKTFLQTAQSLKLQGEPDWSEKI
DQYLYGETLSDND
NT seq 402 nt NT seq  +upstreamnt  +downstreamnt
atgctcagagaattaagaacaaacagggcatcctggaagatatttactgggaagaaattg
agaaagcagtatctattgagcttgatttcaactcagcgttcaagtcttgataatacaaaa
gaaggtcaggctatactgaaaaaagtccacagcttttataaaatgatgcttcaagaactc
gaagccgtatttgacggcacagctcttcaattggaagttcccttaaaccttgccgcaggt
acgagggtgcgaattgttgttgaaagtgttctaccaaatgaagtaaaagcacctaaaacg
tttcttcaaactgctcagtctttaaaattacagggtgaacctgattggtcagagaaaatt
gatcaatatttgtatggggaaactctttctgacaatgactga

DBGET integrated database retrieval system