KEGG   Synechocystis sp. PCC 6803: sll1715
Entry
sll1715           CDS       T00004                                 

Definition
(GenBank) unknown protein
  KO
K07065  uncharacterized protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09194 Poorly characterized
   99997 Function unknown
    sll1715
SSDB
Motif
Pfam: PIN PIN_12 PIN_3 ECH_1 TPR_7
Other DBs
NCBI-ProteinID: BAA17455
CyanoBase: sll1715
CYORF: sll1715
UniProt: P73415
Position
complement(968487..968960)
AA seq 157 aa
MNLIGQRKLINICMGKLFLTMTEVFLDTSFAIALSSITDQNHVRAIQLANQIEANKIRLV
TTQGILLEIGNALSKQRYRKAAIQLLESLETDPSVEVVLLTNSLYKSAFNLFKQREDKEW
GLVDCISFIVMQDRGITDVLTADIHFQQAGFRALLRD
NT seq 474 nt   +upstreamnt  +downstreamnt
gtgaacctgattggtcagagaaaattgatcaatatttgtatggggaaactctttctgaca
atgactgaagtttttttagatacatcttttgcgatcgcattatcttccatcactgatcaa
aatcatgtacgggctattcagcttgctaatcaaattgaggctaacaaaattcgtctagta
acaacccaaggtatcttgctagagataggcaatgcgctttctaagcaaagatatagaaaa
gcggcaatccaacttttagaatccctggaaactgatcccagtgttgaagtcgttctatta
actaacagtctatacaaatcagcatttaatttgtttaagcaacgagaagacaaggaatgg
ggtttagtggactgcatatcattcatcgtgatgcaggatcgaggaatcactgatgtactg
actgccgatatccattttcagcaggcaggatttcgggcactattaagggattaa

DBGET integrated database retrieval system