KEGG   Synechocystis sp. PCC 6803: sll1755
Entry
sll1755           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF5989 H_PPase
Other DBs
NCBI-ProteinID: BAA17704
CyanoBase: sll1755
CYORF: sll1755
UniProt: P73659
Position
complement(1245892..1247115)
AA seq 407 aa
MKQWRKLPNLGFYCYHPNPIAVEKIAQNTDCQDIYKAMLVALGLAIAVAGYFYWAKFDGQ
ITGFFRIGSVLPLSPLLNPAETLIYQGELGYDGQQFLTIALDPGLQNDGSIAALDHPSYR
YRRILYPLLGYLLGLGNPVLIPWALVLINILAIAVCTGLTAVYFQSQKQKTIGVLIVLAI
PGIWMVLFLSTADLLASAFSMGAVVCQQIFPPHQSKKWWLVPILLALALLTRETSLIIWL
AIALTLVQNQQWRSMVALLLSLIPLTLWLGYIRWRQLPGGSGTGNFGWPLVGIGEKFQSL
IQAGLTGNNIYEAYLWLLFLLSLALLIWLTLPRRQSNRTLAYGGWLYGGLLLVASFYILN
YYLNYSRVFLDLFLLTILAMAPTSKLIRWPYLAISGLGTVTFLLLKS
NT seq 1224 nt   +upstreamnt  +downstreamnt
gtgaagcaatggaggaaactccctaatcttggcttctattgttatcatcccaacccgatc
gccgtggaaaagattgctcaaaacactgattgtcaagacatttataaagcgatgttggtg
gccttggggctggcgatcgcagtggcggggtatttctactgggcaaaatttgacgggcag
atcacgggatttttccgcattggttcggtgctgcccctgtccccattgttgaatccggcg
gaaacgttaatttaccaaggggaattgggttacgacggccaacaatttttaaccattgcc
ctggatccggggttacaaaatgacggctccattgcggcccttgatcatcccagctatcgt
tatcgccgtattctttatcctctgctgggctatctgcttggtttaggcaatccggtgtta
attccctgggctttggtgttgattaatattttggcgatcgccgtttgtacaggcttaact
gctgtttattttcaatctcaaaaacagaaaaccattggagtcttaatagtgctggccatt
ccagggatttggatggtgctatttctctccacagcggacttactggccagtgctttcagt
atgggggcagtggtctgtcagcaaatatttcccccccatcaaagtaaaaaatggtggctg
gtgcctatcctcttggccctagcgttattaaccagggaaacatcgttaattatctggctg
gccattgctctaacgttggtgcaaaatcaacaatggcgatcgatggtcgcgttattactc
agccttattcccttgaccctttggttaggctatatccgttggcgacagttgccagggggc
agtggcaccggcaatttcggttggccattggtggggataggggaaaaatttcagagtttg
attcaagcaggactgacgggtaacaacatctacgaggcctatctctggctgttattcttg
ctaagtctggcattactcatttggcttaccctgccccggcgtcaaagcaacagaacctta
gcctacggcggctggctctatggcggtttgttactggtggccagcttttatattctcaat
tactacctcaattacagccgagtttttctcgacctttttctactcacgatcctggccatg
gccccaacctcgaagttgatccgttggccctacttggcgatctccggcctgggtacggtg
actttcttattgctcaaatcctga

DBGET integrated database retrieval system