KEGG   Synechocystis sp. PCC 6803: sll1768
Entry
sll1768           CDS       T00004                                 

Definition
(GenBank) OppB in a binding protein-dependent transport system
  KO
K02033  peptide/nickel transport system permease protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02024  Quorum sensing
Brite
KEGG Orthology (KO) [BR:syn00001]
 09140 Cellular Processes
  09145 Cellular community - prokaryotes
   02024 Quorum sensing
    sll1768
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll1768
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Peptide and nickel transporters
   Peptides/nickel transporter
    sll1768
SSDB
Motif
Pfam: BPD_transp_1 Sid-5
Other DBs
NCBI-ProteinID: BAA17676
CyanoBase: sll1768
CYORF: sll1768
UniProt: P73631
Position
complement(1223666..1224646)
AA seq 326 aa
MPMSPLPPAVGLICKRLAIAVITLLGISLVIFSLLALAPGNPLGELATNPSISQEVRDNL
RRSLGLDQALPIRYLKWLWSLLQGDLGYSFTSRSPVIDLIGQRLPTTLWLMGTAYLISLA
IAIPLGVTAALYRGRWWEPLISGISLMGFSLPTFLTGLLFILIFSVQLRWLPFIYDSTLT
VDSMASLGTQIRQLLMPVGVLVFYQSAVILRFVRSAALEELPQNYIRTAYAKGLGTWGML
KNHLLKNASLPLITLIALDVPTIFTGALVTEQVFRVPGIGALLIESIYRSDTPVVMAVTF
LYAVLIVFFSSLADLIYQLVDPRIRW
NT seq 981 nt   +upstreamnt  +downstreamnt
atgcccatgtcccccttgccccctgccgttggcctgatctgtaaacgtttggcgatcgcc
gtcatcaccttgttgggcattagtttagtgatttttagtttgttagccctcgccccgggc
aatcctttgggggaattggccactaacccctccatttcccaggaagtgcgggacaatttg
cgccgcagtttggggctggaccaagcgttacccatccgttacctaaaatggttatggagt
cttttgcagggggatttgggttattccttcaccagccgtagtcccgtaattgatttgatt
ggtcaaaggctaccgacaacgttgtggttaatgggcacggcctacctgatcagtttggcg
atcgccattcctttgggagtgacagcggcattgtaccggggacggtggtgggaaccgtta
atcagtggcatcagtttaatgggcttttccctgcccacttttttgaccgggttactgttc
atcctaatttttagtgtgcagttgaggtggttacccttcatttacgacagcactctgacg
gtggatagcatggctagtttgggaacccaaatccgtcaactattgatgccagtgggggtg
ttagtgttctatcaatcggcggtaattctacgctttgtccgttccgccgcgttggaagag
ttgccccaaaattacattcgcaccgcctatgccaaaggtttaggcacctggggaatgttg
aaaaaccatcttttaaaaaatgcttctttgcccctaatcacccttattgccctggatgta
cccaccattttcaccggagctttagtaactgagcaggttttccgagtaccaggcattgga
gctttgttaattgaatccatttatcgcagtgacacccccgtggtgatggcggtcactttt
ctttatgccgttttaattgtctttttcagtagtttggcggatttgatttaccaactggtg
gacccccgcattcgttggtaa

DBGET integrated database retrieval system