KEGG   Synechocystis sp. PCC 6803: sll1776
Entry
sll1776           CDS       T00004                                 

Gene name
deoC
Definition
(GenBank) deoxyribose-phosphate aldolase
  KO
K01619  deoxyribose-phosphate aldolase [EC:4.1.2.4]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00030  Pentose phosphate pathway
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09101 Carbohydrate metabolism
   00030 Pentose phosphate pathway
    sll1776 (deoC)
Enzymes [BR:syn01000]
 4. Lyases
  4.1  Carbon-carbon lyases
   4.1.2  Aldehyde-lyases
    4.1.2.4  deoxyribose-phosphate aldolase
     sll1776 (deoC)
SSDB
Motif
Pfam: DeoC CbiC DHO_dh NIR_SIR_ferr
Other DBs
NCBI-ProteinID: BAA17663
CyanoBase: sll1776
CYORF: sll1776
UniProt: P73618
Position
complement(1208020..1208697)
AA seq 225 aa
MEKSRQFDLAPYIDHAALDPATTREAIATCCAQALHHKFVAVCVYPSALSQAVELLRGKK
VEICAVIGFPSGASTSGSKLYEAQEAAELGATELDVVINLGLLKDGNTEAVYNDIAPIVE
ATGLTVKAILEMGRLTESEKRLAAEICLDAGVQYLKTSTGWGKGATVADVRLLHQISQGR
VGIKASGGIRTVEQAIALIEAGATRLGTSRGVELIQQQQQLWEQG
NT seq 678 nt   +upstreamnt  +downstreamnt
atggaaaaatcccgtcagtttgaccttgctccctacattgaccacgctgccctagacccc
gccaccacccgtgaggcgatcgccacttgctgcgcccaagccctacaccataaatttgtt
gcggtgtgtgtttatcccagcgctttatcccaagccgtggaattgttgagggggaaaaaa
gtggaaatttgtgcggtaattggttttccctccggagctagcaccagcggcagtaaactt
tatgaggcccaggaagcagcggaattgggggccaccgaattggatgtggtaattaatctg
ggattattaaaagacggtaatacggaagccgtttataacgacattgcccccattgtggaa
gccacagggctaacagtgaaagccattttggaaatgggccggctcacggaatcggaaaaa
agattagcagcggaaatttgtttggatgcaggggtgcaataccttaaaaccagcaccggc
tggggcaagggggccaccgttgccgatgtgcggttgttacatcaaatcagtcaaggacgg
gtggggattaaagcatccggagggattcgcacagtggagcaagccatagcattaatcgag
gccggcgccacccgcttgggcacttcccggggagtggaattgattcagcagcaacaacaa
ttgtgggaacaaggttag

DBGET integrated database retrieval system