KEGG   Synechocystis sp. PCC 6803: sll1902Help
Entry
sll1902           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K00799  glutathione S-transferase [EC:2.5.1.18]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00480  Glutathione metabolism
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09106 Metabolism of other amino acids
   00480 Glutathione metabolism
    sll1902
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    sll1902
Enzymes [BR:syn01000]
 2. Transferases
  2.5  Transferring alkyl or aryl groups, other than methyl groups
   2.5.1  Transferring alkyl or aryl groups, other than methyl groups (only sub-subclass identified to date)
    2.5.1.18  glutathione transferase
     sll1902
Transporters [BR:syn02000]
 Other Transporters
  Pores ion channels [TC:1]
   sll1902
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: GST_N_2 GST_N_3 GST_C_2 GST_C_5 Glutaredoxin GST_N GST_C GST_N_4 GST_C_3
Motif
Other DBs
NCBI-ProteinID: BAA17892
CyanoBase: sll1902
CYORF: sll1902
UniProt: P73835
Position
complement(1451319..1452518)
Genome map
AA seq 399 aa AA seqDB search
MITPLSWQALAELSDYQVDTVNGPTNAQATLRLFGQSKESLQVTLYRDNHAWCPYCQKVW
LWLEEKQIPYRIKKVTMFCYGEKEDWYKKLVPSGMLPALELDGRFYTESDDILIALEKAF
GPLLWAMEDPLVLPLRKLERLLFRAWCNWLCYPAMFPGADQRNQQQFQQVVNQVEKALEK
LPGPYFLPEFSTADIVFVPYVERMNASLFYYKGYSLREDNPRLKDWFAALETRMTYRGTQ
SDFHTHAHDLPPQMGGCYSNGSVQAQQNQQRVDNGPWFGLPDATCPEPENVKQEAIARVV
KHHENIIKVNAHNQGEKFDQALRCALTLLATGEKCAAPQGTDQALRYLRDRINVPRDMSI
YAAKHLRQALETTASLVGDSEGEPIPVRHRRDQDPANFR
NT seq 1200 nt NT seq  +upstreamnt  +downstreamnt
atgattactcccctttcttggcaagctttagctgaactatccgactatcaggtggatacg
gttaatggtcccaccaatgcccaggcaactctgagattatttggacaatcaaaggagtct
ttacaagttactctttatcgcgataaccatgcctggtgcccctattgtcaaaaagtttgg
ttatggttagaagaaaagcaaattccttaccgaatcaaaaaggtgaccatgttttgctat
ggggaaaaggaggattggtataaaaaattagtgccatcgggaatgttgcctgccttggaa
ctggatggtagattttacactgaaagcgatgatattttaatagccttagaaaaagctttt
ggaccattgctttgggcgatggaagatccattggtattaccccttagaaaactagaaagg
ttactgtttcgagcctggtgtaattggctctgctaccctgccatgtttcccggtgctgat
caacggaatcaacaacagtttcaacaggtggtgaatcaagtggaaaaagcattggaaaaa
ttacctggcccgtatttcttaccagaatttagcactgctgacatcgtttttgttccctac
gtggagcgcatgaatgcgagcttgttttattacaaaggttattccctaagggaggataat
ccccgcttaaaagactggtttgcggcgctggaaacccggatgacctataggggtacccag
agtgatttccatacccatgcccatgatttgccgccccaaatgggtggttgttactccaac
ggtagtgtccaggcccagcagaatcaacagcgggtggacaacggcccttggtttggttta
cccgatgccacctgcccggaaccggaaaatgttaagcaagaggcgatcgccagggtggtg
aaacaccacgaaaatattattaaggtcaatgcccataaccagggggaaaagtttgatcaa
gctctgcgctgtgcgttgaccctactggccacgggggaaaaatgtgcggcaccccagggt
acagaccaagcattgcgttatctgcgggatcggattaatgtgcccagggatatgtccatt
tatgcagctaaacatcttcgtcaagctttggaaaccaccgccagtttagtgggggacagc
gaaggagaacccattccagtgcgccaccgccgggatcaagacccagcaaattttcgctga

DBGET integrated database retrieval system