KEGG   Synechocystis sp. PCC 6803: sll2013
Entry
sll2013           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: DUF1997
Other DBs
NCBI-ProteinID: BAA17710
CyanoBase: sll2013
CYORF: sll2013
UniProt: P73665
Position
complement(1254036..1254623)
AA seq 195 aa
MRVTFSATEQLQLRQSEPLPSLQHYLRQPQRLVQAIADPKLMEVLPGDQFRLKMRPLNFL
DIYHFQPTVVLKVWANATGTVFLESESCEIRGIDYINHRFSLQLKGRLAPYCQDGHTLLQ
GKADLQVGVDLPQALWLTPKPLLEMAANGLLRGVLARIKQRLQGQLLADYQQWLAQQNDN
LVTQASPTAEALEAI
NT seq 588 nt   +upstreamnt  +downstreamnt
atgcgagttaccttttccgccaccgaacaattacaactgcggcagtctgaacctctgcct
agtttgcagcactatttacgccaaccccagcgcctagtccaggcgatcgccgaccctaaa
ttgatggaagtgctaccaggcgatcagtttagattgaaaatgcgaccgctcaatttttta
gatatttatcattttcaacccacagtggtactgaaagtgtgggccaacgccactggcact
gtatttttagaatcggaaagctgtgaaatccggggcatcgactatattaaccatcgcttt
agtttgcaattaaaaggtcgtttggctccctattgccaagatggccataccctcctccag
ggcaaagcagatttgcaagtgggagtagatttgccccaggccctttggttaactccaaag
ccgttgttagaaatggcggccaatggtctattgcggggagttttggcccgcatcaaacaa
cgactccaaggacaactattggcagattatcaacagtggttggcccagcagaatgataat
ctagtaacccaggcttctcccactgctgaagctttggaagcaatttag

DBGET integrated database retrieval system