KEGG   Synechocystis sp. PCC 6803: slr0073
Entry
slr0073           CDS       T00004                                 

Definition
(GenBank) sensory transduction histidine kinase
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Hpt Exog_C MIEAP
Other DBs
NCBI-ProteinID: BAA10540
CyanoBase: slr0073
CYORF: slr0073
UniProt: Q55788
Position
2869752..2870699
AA seq 315 aa
MLGEWPSKFEGTTLDQQKILGYFIEEAQEHLETLERGILDLGKVVQDSEQVNEMFRAAHS
IKGGAAMLGYTSIQKTAHRLEDAFKVLKEHQLPVDQKLESLFLNGYDVLQDLVEKLQSPA
GLQPEEADSIVDGAAYQFEELQNYLNYLLNQGSATATSTQTMAAKSTSTGTFNESDVPEE
IKVLLHKMLQLFKQEPSATSREKLQEYCTRLGRLAPKQENWQHLLSLSKQAIANPLHSYR
TLAPVVLKDLKQGYDCFVLAKPGNIRVSDGLKQLASSQVAQVLIPADPAAAASVLMKVFN
DSQLRQLIKNLSAAR
NT seq 948 nt   +upstreamnt  +downstreamnt
atgctaggggagtggccatccaaatttgagggtacgaccttggatcagcaaaaaatcctc
ggctattttatcgaagaagctcaggagcatttggaaaccctggaacggggcatccttgac
ttgggtaaggtggtgcaggactcggaacaggtcaacgaaatgtttcgggcggcccattcc
attaaagggggggcggccatgttgggctacaccagcatccaaaaaacggcccatcgtttg
gaagatgccttcaaggtgttgaaggagcatcaattgcccgtggatcaaaaattggagtcc
ctattcctcaacggctacgatgtcttgcaggatttggtggaaaaattgcagagtcccgct
ggacttcagccagaagaggcagattccattgtggatggggcagcatatcagtttgaagag
ttacagaattatctgaattatctcctcaaccagggcagtgccacggccacttctacccaa
actatggcggccaagtccaccagtacaggtacgttcaatgagagtgatgtgccggaggaa
attaaggtcctgctacataaaatgttgcagttgtttaagcaggaaccatcggccacttct
cgggaaaaacttcaggaatattgcactcgtctgggtcgcctagcccccaagcaagaaaat
tggcagcatttgctctccctcagtaaacaggcgatcgccaatccattgcattcctaccgt
accttggccccggtggtgctgaaggatcttaaacagggctatgactgttttgtgttagcc
aagcctggaaacattcgggtcagcgatggtcttaaacaattggcctctagccaagtggcc
caggttctcattccagcagacccagcggcggcagctagcgttctcatgaaggtattcaac
gacagccaactgcgtcaattgattaaaaatctttctgccgcccgttag

DBGET integrated database retrieval system