KEGG   Synechocystis sp. PCC 6803: slr0079
Entry
slr0079           CDS       T00004                                 

Gene name
gspE
Definition
(GenBank) general secretion pathway protein E
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: T2SSE T2SSE_N AAA_22 NapD Rpr2 Med9
Other DBs
NCBI-ProteinID: BAA10551
CyanoBase: slr0079
CYORF: slr0079
UniProt: Q55799
Position
2881378..2883819
AA seq 813 aa
MVFSSDSPEFSLSPFEQALIEAGYLSLSQIHQALMEARRTGIALPTLVETILGESLPDEL
HRQYQAQQRFALSVIHGVKFFDQHQLTTLANTEAIASLLNRYFPLPICRQYGFLPLHYRE
NPGALLVVMVDPSDPEASQFLQRQLAPHRLTLRRRGVTKDDFDNLIDQLYHDPEVQAALN
AHRQTEISEDPYDGKATVVEVTEIIEDLPQQIAALQNTPPVAPPPVSAIAENTNDSNPEA
KSEGPEVKLANKILILGLREGASEIHIDPQDNRVLVQIRQGGNLRMLLEPLPRELGPKLV
ARVKTMAHLDTSQTNIPQKARIRKSYNGQSVFFYVNILPSFYGEKILVRVVPHLEKLPDF
AQLCGDRQSQESLQRLAQESQGLVVVIGAAYGGKTTTMEAFLGQQLDQNRSVALVSDPLV
HVYENINQLEVNPQKDFTSEKAVQSLQDQWPAVMAVDPLEDQETAQILTQVLNQGHLVFT
SVIAKDVPSAIAQLQQWFEPAVLGQHLKGIVSQRPVRRVCPACRLRGEVTPEEQQRFGLP
PGTIYRANSLSMELMAQPMIKSRLCRQCHGLGYSGMTGIFEVVAITPELQQLVSSPCSHA
EIINGLSQAGIASPARQAITLVSQGVTTLEEVTRLFPQLPRQLSPRSSPPEAISAQSSPM
TPPATQTIPGETMFSDDQWWQRLQQLEKSVQELNRALADLKKMAGDRPSAHRTRAGDHHS
PSAAGPNLDLMAELQALEDLSAHKRPKARDRHEQAVTVMEGFDQIEELLIDDQLGQPAAA
PFNAGEETFIAEEEANVPEGKKFNPFKSVIDPW
NT seq 2442 nt   +upstreamnt  +downstreamnt
atggtcttttcctccgattcccccgaatttagcctctccccttttgaacaagccctcatt
gaagcgggttatctttccctttcccaaattcatcaggctttaatggaggcgcgtcgcacc
ggcattgctctgccgactttggtggaaacaatattgggggaatctttgcccgatgaacta
catcgccagtaccaagctcagcaacggtttgccctttcggtgatccatggggtgaagttt
tttgaccaacatcagttaacgaccctggccaacaccgaggcgatcgccagtttactgaac
cgttactttcctttgcccatctgccgtcagtatggttttttacccctccattaccgggaa
aatccgggggctttgttagtggtgatggtggaccccagcgacccggaagcaagtcaattt
ttacaacgacaactagcgccccatcggcttaccctgcggcggcggggggtgaccaaggat
gattttgataatttaatcgatcagctttaccacgatccggaagtgcaggccgccctgaac
gcccaccgccaaactgagattagtgaagatccctacgatggcaaagcaacggtggtggaa
gtaacggaaattattgaggatttaccgcaacaaatcgcagctctgcagaatactcccccg
gttgctcccccgccggtcagtgccatagccgaaaatacaaatgattctaatccagaggcc
aaatccgaagggccagaagttaaattagctaataaaattctcatccttgggttgcgggaa
ggggccagcgaaattcacattgacccccaggataatcgggtgctggtgcagattcgtcag
ggtggtaatctccggatgttgcttgaacccctgcctagggagttaggccccaaattggtc
gccagggtgaaaaccatggcccatttggacaccagccagaccaacatcccccaaaaggcc
cgcatccgcaaaagttataatggccagtcagtatttttctacgtcaatattctgcccagt
ttttacggtgaaaaaatactggtacgggtggttcctcacctagaaaaattacctgatttt
gcccaactttgtggcgatcgccagagccaggaaagtttacaaagattagcccaggaatcc
caaggtttagtggtggtaattggggcggcctatggcggcaaaaccactaccatggaagct
tttttgggacagcagttggaccagaatcgctccgttgccttggtgtccgatccccttgtc
catgtttatgaaaacattaatcagctagaagtaaacccccaaaaggactttaccagcgaa
aaggcagtgcagtccctccaggatcaatggcccgcagtgatggcagtggatcccttggag
gatcaggaaacagcccaaattttgacccaagtcctcaaccaaggccatttagttttcacc
tctgtcattgccaaagatgtgccctcggcgatcgcccaactgcagcaatggtttgaacca
gcggtattggggcaacacctgaagggcattgtttcccagcggccagtgcgacgggtctgt
ccagcctgtcgtttgaggggggaagtgacaccggaagagcaacaacgttttggtctgcct
ccgggaactatttatcgggctaacagtttgagtatggagttgatggcccaacccatgatc
aaaagtcgtctctgtcgtcagtgccatggccttggttactctggcatgacggggatattt
gaggtcgtggccattactcctgagctccaacagttagtcagtagcccctgttcccacgca
gaaattatcaatggtttaagtcaagctggcattgctagtcccgctcgccaggcgatcacc
ctagtgagtcagggagtcaccaccctcgaagaagtgaccagactttttccccaattgccc
cggcaactatcgccccgatcgtccccccctgaagctattagtgcacaatcatcaccaatg
actccccccgcaactcaaaccatcccaggggaaactatgttctccgatgaccaatggtgg
caacgtctgcaacaactggaaaaatctgtgcaggagcttaaccgtgccctggcggatttg
aaaaaaatggctggcgatcgcccttctgctcaccgtacccgggctggcgatcatcattcc
ccatcggctgctggccccaacttagacctcatggcagaattgcaggccctggaggattta
tctgcccacaaaaggcccaaggctagggacagacatgaacaagccgtaaccgttatggaa
ggttttgatcaaattgaagaattattaattgacgatcaattgggccaacctgccgctgcc
cccttcaatgccggggaggaaacctttattgcagaagaagaagctaacgtcccggagggg
aaaaaatttaatccgtttaaatctgtgattgacccctggtaa

DBGET integrated database retrieval system