KEGG   Synechocystis sp. PCC 6803: slr0080
Entry
slr0080           CDS       T00004                                 

Gene name
rnhA
Definition
(GenBank) ribonuclease H
  KO
K03469  ribonuclease HI [EC:3.1.26.4]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn03030  DNA replication
Brite
KEGG Orthology (KO) [BR:syn00001]
 09120 Genetic Information Processing
  09124 Replication and repair
   03030 DNA replication
    slr0080 (rnhA)
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03032 DNA replication proteins [BR:syn03032]
    slr0080 (rnhA)
Enzymes [BR:syn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.26  Endoribonucleases producing 5'-phosphomonoesters
    3.1.26.4  ribonuclease H
     slr0080 (rnhA)
DNA replication proteins [BR:syn03032]
 Eukaryotic type
  DNA Replication Elongation Factors
   RNase H
    slr0080 (rnhA)
 Prokaryotic type
   Elongation factors (bacterial)
    RNase H
     slr0080 (rnhA)
   Elongation factors (archaeal)
     slr0080 (rnhA)
SSDB
Motif
Pfam: RNase_H RVT_3 NRDE-2 DDE_Tnp_1
Other DBs
NCBI-ProteinID: BAA10553
CyanoBase: slr0080
CYORF: slr0080
UniProt: Q55801
Position
2884357..2884839
AA seq 160 aa
MASTPNSVTLYTDGACSMNPGPGGYGAVILYGDGRREELSAGYKMTTNNRMEIMGAIAAL
SHLQEPSQVLLYTDSRYMVDAMSKGWAKKWKANGWQRNAKEKAKNPDLWETMLTLCEKHQ
VTFQWVKAHAGNKENERCDRLAVAAYQNNPNLVDEGFGKF
NT seq 483 nt   +upstreamnt  +downstreamnt
atggcctctacccccaattccgtaactctctacaccgatggtgcctgctccatgaatcct
ggccctggtggctatggcgcagtgattctctacggtgatggtcgtcgggaggaattgtcc
gccggttataaaatgaccaccaataatcgcatggaaattatgggggcgatcgccgccttg
agtcatttacaagaaccgtcccaagtgttgctctataccgattcccgctatatggtcgat
gccatgagcaagggttgggccaagaaatggaaagccaacggatggcaaaggaatgccaag
gaaaaggccaaaaaccccgacctgtgggaaacgatgttaacgctgtgcgaaaaacatcaa
gttacattccagtgggtcaaagcccacgctggcaataaggaaaatgagcggtgcgatcgc
ctagcggtggccgcctatcaaaataatcccaacttagtagatgaaggcttcggcaaattc
tag

DBGET integrated database retrieval system