KEGG   Synechocystis sp. PCC 6803: slr0089
Entry
slr0089           CDS       T00004                                 

Gene name
erg6
Definition
(GenBank) delta(24)-sterol C-methyltransferase
  KO
K05928  tocopherol O-methyltransferase [EC:2.1.1.95]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00130  Ubiquinone and other terpenoid-quinone biosynthesis
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
Module
syn_M00112  Tocopherol/tocotorienol biosynthesis
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00130 Ubiquinone and other terpenoid-quinone biosynthesis
    slr0089 (erg6)
Enzymes [BR:syn01000]
 2. Transferases
  2.1  Transferring one-carbon groups
   2.1.1  Methyltransferases
    2.1.1.95  tocopherol C-methyltransferase
     slr0089 (erg6)
SSDB
Motif
Pfam: Methyltransf_11 Methyltransf_25 Methyltransf_31 Methyltransf_23 Methyltransf_12 CMAS Ubie_methyltran MTS Methyltransf_29 Methyltransf_9 TehB Methyltransf_32 UPF0020 MetW Methyltransf_24 DREV tRNA_U5-meth_tr Methyltransf_8 Methyltransf_20
Other DBs
NCBI-ProteinID: BAA10562
CyanoBase: slr0089
CYORF: slr0089
UniProt: Q55809
Position
2896657..2897610
AA seq 317 aa
MVYHVRPKHALFLAFYCYFSLLTMASATIASADLYEKIKNFYDDSSGLWEDVWGEHMHHG
YYGPHGTYRIDRRQAQIDLIKELLAWAVPQNSAKPRKILDLGCGIGGSSLYLAQQHQAEV
MGASLSPVQVERAGERARALGLGSTCQFQVANALDLPFASDSFDWVWSLESGEHMPNKAQ
FLQEAWRVLKPGGRLILATWCHRPIDPGNGPLTADERRHLQAIYDVYCLPYVVSLPDYEA
IARECGFGEIKTADWSVAVAPFWDRVIESAFDPRVLWALGQAGPKIINAALCLRLMKWGY
ERGLVRFGLLTGIKPLV
NT seq 954 nt   +upstreamnt  +downstreamnt
atggtttaccatgttaggcctaagcacgccctgttcttagcattctattgttatttctct
ttgcttaccatggccagcgccaccattgccagtgcagacctctacgaaaaaattaaaaat
ttctacgacgactccagcggtctctgggaagacgtttggggtgagcatatgcaccacggc
tactacggtccccacggcacctatcggatcgatcgccgccaggctcaaattgatctgatc
aaagaactattggcctgggcagtgccccaaaatagcgccaaaccacgaaaaattctcgat
ttaggctgtggcattggcggcagtagtttgtacttggcccagcaacaccaagcagaagtg
atgggggctagtctttccccagtgcaggtggaacgggcgggggaaagggccagggccctg
gggttgggctcaacctgccagtttcaggtggccaatgccttggatttgccctttgcttcc
gattcctttgactgggtttggtcgttggaaagtggggagcacatgcccaacaaagctcag
tttttacaagaagcttggcgggtacttaaaccaggtggccgtctgattttagcgacctgg
tgtcatcgtcccattgatcccggcaatggccccctgactgccgatgaacgtcgccatctc
caagccatctatgacgtttactgtttgccctatgtggtttccctgccggactacgaggcg
atcgccagggaatgtgggtttggggaaattaagactgccgattggtcagtggcggtggca
cctttttgggaccgggtgattgagtctgcgttcgatccccgggtgttgtgggccttgggg
caagcggggccaaaaattatcaatgccgccctgtgtttacgattaatgaaatggggctat
gaacggggattagtgcgttttggcttattaacggggataaagcctttagtttga

DBGET integrated database retrieval system