KEGG   Synechocystis sp. PCC 6803: slr0092
Entry
slr0092           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Glycos_transf_2 Glyco_tranf_2_2 Glyco_tranf_2_3 Glyco_trans_2_3 Glyco_transf_21 Glyco_tranf_2_4 DUF4543
Other DBs
NCBI-ProteinID: BAA10565
CyanoBase: slr0092
CYORF: slr0092
UniProt: Q55812
Position
2900089..2900862
AA seq 257 aa
MADRPQLSIIIPVFNEAKILQKSPTENTRQYLGQFTEDQRIEILIIDGGSQDSTVELCQT
YADSLPLHVFISPQTGRANQMNYGASLSRSEWLLFLHLDSILPHDFFTQIAEILTNSSYI
AGAFGLTIDLPGRPYRWLEKLILWRSIYAQKPYGDQGLFIQRQDFQQLGGFADLPIMEDY
QFMQKLGKQRGKVAIAGGKVITSGRRWQKLGLLRTTAINQLVVAGYHLGVSPQTLVHWYR
GAKPNRGNRPNSDGTSC
NT seq 774 nt   +upstreamnt  +downstreamnt
atggccgaccgtccccagttgagtattattattcccgtgtttaatgaagcaaaaatttta
caaaagtctccgactgaaaataccagacaatatttgggacaatttaccgaggatcaacgg
atagaaattttaattattgatgggggcagtcaggatagcacagtggagttatgccagacc
tatgctgattctttacctttacacgtttttattagtccccaaacagggcgggctaaccaa
atgaattatggtgctagtttatctaggagtgaatggttattatttttacatttagatagt
attttgccccatgacttttttactcaaattgctgagatattaaccaattctagttacata
gccggagcttttggtttaactattgatctccccggtagaccctatcgttggctagaaaaa
ttaattctttggcgctccatttacgcccaaaaaccctatggcgatcaaggtttatttatc
caacggcaagattttcaacagttgggagggtttgctgatttgcccattatggaagattac
caatttatgcaaaaactgggaaaacaacggggcaaggtggcgatcgccgggggcaaagtg
attacatctggacggcggtggcaaaagctggggctactgcggactacggccattaaccag
ctggtggtggcgggctatcatctgggggtttctccccaaaccttggtccattggtatcgg
ggggcaaaaccgaatcgggggaaccggccaaactccgacgggacttcttgttag

DBGET integrated database retrieval system