KEGG   Synechocystis sp. PCC 6803: slr0093
Entry
slr0093           CDS       T00004                                 

Gene name
dnaJ
Definition
(GenBank) DnaJ protein
  KO
K05516  curved DNA-binding protein
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09180 Brite Hierarchies
  09182 Protein families: genetic information processing
   03110 Chaperones and folding catalysts [BR:syn03110]
    slr0093 (dnaJ)
   03036 Chromosome and associated proteins [BR:syn03036]
    slr0093 (dnaJ)
Chaperones and folding catalysts [BR:syn03110]
 Heat shock proteins
  HSP40 / DNAJ
   slr0093 (dnaJ)
Chromosome and associated proteins [BR:syn03036]
 Prokaryotic type
  Nucleoid associated proteins
   Other nucreoid associated proteins
    slr0093 (dnaJ)
SSDB
Motif
Pfam: DnaJ_C DnaJ CsrA
Other DBs
NCBI-ProteinID: BAA10566
CyanoBase: slr0093
CYORF: slr0093
UniProt: P50027
Position
2900980..2901978
AA seq 332 aa
MASTDFKDYYQILGVTKTASEAEIKKQFRKLALKYHPDKNPGDKAAEEKFKEISEAYEVL
SDPEKRQKYDQFGRYWQQAGTAGQPSGSYGPGVGVDFGGFDFSQYGNFDEFINELLGRFN
TPGGGGQRTSYSYSTGGPGFNDFGGFGNAQAPAGDREATLQLTLAEAFRGVEKRLNLGEE
MVTVRIPAGAKNGSRVRVRGKGMASPYGQRGDLYLNLQLTPHPFFQFEGDNLVCELAIAP
DEAVLGADISVPTPDGMVRMKVPAGVKSGQSLRLKGKGWPNPKQGRGDQLVRLIITAPKN
PSAIERECYEKIQAQRTENPRQAVEKYANLLA
NT seq 999 nt   +upstreamnt  +downstreamnt
atggcatcaacagatttcaaagactattaccaaattttgggagtgaccaaaaccgcttca
gaagctgaaatcaaaaagcagtttcgtaaattagcactgaaatatcatcctgacaaaaat
cctggggataaggcggcggaggaaaaatttaaggaaattagcgaagcctatgaggtgctt
tctgaccccgaaaaacgccagaaatatgaccaatttggccgctattggcaacaggctggc
acggcaggacaacccagtggcagctacggccctggagtcggcgtggattttggtggcttt
gactttagccagtacggcaattttgacgaatttattaatgaactgttgggacgcttcaat
acccccggtggcggcggtcagagaacttcctacagctattccaccggcggccctggcttt
aatgactttggtggttttggcaatgcccaggcccccgcaggcgatcgggaagcaacccta
cagttaactttggcggaagcttttcggggagtggaaaaacgtctcaacttaggggaagaa
atggtcactgtgcggattcccgccggagcgaaaaatggcagtcgagtacgggtgaggggc
aaaggtatggccagtccttacggtcaaaggggggatttgtatctcaacttgcaactgacc
ccccatccatttttccaatttgaaggggataacctggtctgtgaattggcgatcgccccg
gacgaagcggtgttgggggccgatattagtgtaccgacccccgatggcatggtgcgaatg
aaagtcccggcaggagtcaaatccggccaatccctgcggttaaaagggaaaggttggccg
aaccctaaacagggccgtggtgaccagttagtacgcctaatcatcactgctccgaaaaat
cccagcgccattgaacgggaatgctatgaaaaaattcaggcgcaacggacagaaaatccc
cgccaagcggtggaaaaatacgccaatttgttggcatag

DBGET integrated database retrieval system