KEGG   Synechocystis sp. PCC 6803: slr0104
Entry
slr0104           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K07037  cyclic-di-AMP phosphodiesterase PgpH [EC:3.1.4.-]
Organism
syn  Synechocystis sp. PCC 6803
Brite
KEGG Orthology (KO) [BR:syn00001]
 09190 Not Included in Pathway or Brite
  09191 Unclassified: metabolism
   99980 Enzymes with EC numbers
    slr0104
Enzymes [BR:syn01000]
 3. Hydrolases
  3.1  Acting on ester bonds
   3.1.4  Phosphoric-diester hydrolases
    3.1.4.-  
     slr0104
SSDB
Motif
Pfam: 7TMR-HDED 7TM-7TMR_HD HD
Other DBs
NCBI-ProteinID: BAA10634
CyanoBase: slr0104
CYORF: slr0104
UniProt: P54371
Position
2973268..2975703
AA seq 811 aa
MKAIFALRQAVASQLKKSTASSHPLPRTTASTSQDETIWQKIHRSRFVRIAHPPVMLGIT
VVSLTGVVGYRFYNQPQLSVGTESPYTIYAPEDGSFVDERTTEEKRKEVRAGTIPRLQRD
NELTAQLKQERSQYLDAINQLRYLAGTFPYIDTKIFTLEQQHLLRSLGPGEWQQLEDYIS
YGQPLPMASPQLAKLQQLFDQQKATTSPETMAGLLTSIRTAQDRYGRVTARLAEVKADRQ
ITNNQIGALKLDGPTWQTTQQTIIQVHDRILTQGLPAGITAPLLGETVQLHLRNILPPQA
HQVAENSLNNLLKDKYNLTVDKEATKNLAEKAVLAMENVKVSAEKNSVIVRAGEVITQEQ
FVLLDGYGLSQRQVNWQGLLRTAGLVGGALIIFCGVSRRIHRPLRRRDHILLCLLSVSTP
VLFLLDPVYNNLPAISLLTSSFYGPTLAITQVVLVGGLSAFAMESIVWEYLLGSAAAALL
AGMIASKLRSRDELALLGVGVGATQGIVYLFTYLIVNASAVTIIWYTALPSAIVYGLLGL
AWSAMAIGVSPYLERLFDVVTPTRLVELSNPNCPLLQRLAKEAPGTFQHTLFVACLAESA
ARELRCNVELVRTGTLYHDIGKMHDPLGFIENQMGGPNKHDEINDPYVSVDIIKKHVSEG
LVMARRYGLPQVVRDFIPEHQGQMLISYFYIQAKEAAERAGEPPVNEEEFRYTGPIPQSR
ETGIVMLADSCEAALRSLREANPETAMAMVNRIFKARWRDNQLQDSGLKYEELPIIADVF
VRVWQQFHHQRIAYPKAALDVQVTSPSTTRF
NT seq 2436 nt   +upstreamnt  +downstreamnt
atgaaagcaatttttgccctccgccaagcagtggcgtcccaactaaaaaagtccactgcc
tctagccatcctctccccaggaccacggcctccacttcccaagatgaaaccatttggcaa
aaaatccaccgctccaggtttgtacgcattgcccacccaccagtgatgttgggtattaca
gtggtgtccctcaccggggtagtgggttaccgtttctataaccagccccagctcagcgtt
ggcaccgaatctccctacaccatttacgccccggaagatggcagttttgtggacgaaaga
accacagaggaaaagcggaaggaagtgcgggccggtaccattccccgcctacaaagggat
aacgagttaaccgcccaactcaaacaagaaagaagtcaatatctggatgccatcaaccag
ctccgctacctagccggtacctttccctacatagacaccaagatttttaccctggagcag
caacatttactccgtagtctggggccaggggaatggcaacaattggaagattatattagc
tatggccagccactgcccatggcttcaccccagttggccaaactgcaacagttatttgat
caacaaaaagccaccacttcccctgagaccatggcgggcttactcaccagcatcaggacc
gcccaggatagatatggtcgggtgacggctcgcttggcggaggttaaggccgatcgccag
attaccaataaccagatcggggcattgaagttagacgggcccacctggcaaactacccaa
cagaccattatccaagtccatgaccgcattctcacccagggcctaccggcgggcatcact
gctcctctgttgggggaaacggtacaactccatttgcgcaacattttgcccccccaggcc
caccaagtggcggagaatagcttaaataatttactcaaggataaatataatctgactgtt
gacaaggaagccaccaaaaacttggcggaaaaagcggtactggccatggaaaacgtcaaa
gtatccgccgagaaaaacagtgtgattgtgcgggcgggggaagtcattacccaagagcaa
tttgttttgttggacggttatggcctgagtcagcgccaggtgaactggcaaggcctgttg
cggacagcggggttggtggggggcgctttaattattttctgtggagtaagtcggcgtatc
catcggcccctacggcggcgggaccatattctcctctgtttgctcagcgttagcactcca
gtcttatttttgcttgacccggtctataacaacctgccggccatcagtttgctcaccagt
agcttttatggccccaccctggccatcacccaagtggtattggtggggggattgtccgcc
tttgccatggaatccattgtttgggaatacttattgggcagtgcagcggcggccttgcta
gcgggtatgattgccagtaagctccgttctcgggatgagttggccctgttgggggtaggg
gtaggggccacccagggcatagtttatttattcacatatttaattgttaacgcctcagcg
gtcacaattatttggtacactgctctgcccagtgccattgtctatggcctactcggtttg
gcttggagtgccatggcgatcggggtttccccttacctagaaagattgttcgacgtggtg
acccccaccaggttggtggaattgagcaatcccaactgccccctgctacaaaggttggcc
aaagaagcccctggtactttccagcacaccctatttgtggcctgtttagctgaatcggcg
gccagggaattgcgctgtaacgttgaactggtgagaaccggaactttgtaccatgacatt
ggcaaaatgcacgaccccttaggattcattgaaaatcagatggggggccctaataaacac
gatgaaatcaatgatccctacgtcagtgtggacattatcaaaaaacacgtttccgaaggg
ttggtgatggcccgacgttacggtttaccgcaggtggtgcgggactttattcctgaacat
cagggacaaatgttgatttcctatttttatatccaagccaaggaagcggcggaaagggcg
ggggaaccgccagttaatgaagaggaattccgttacaccggtcccattccccagtctcgg
gaaaccggcattgtgatgctggcggacagttgtgaggcggcgttgcgttccctcagagaa
gccaatccagaaaccgccatggccatggttaaccgtatttttaaggcccgctggcgagat
aaccaattgcaggatagtggcttgaaatacgaagaattgcccattattgccgatgttttc
gtacgggtgtggcaacagttccatcaccaacggattgcctaccccaaggcggccttagat
gtgcaggtaactagtccttccaccaccagattttag

DBGET integrated database retrieval system