KEGG   Synechocystis sp. PCC 6803: slr0298
Entry
slr0298           CDS       T00004                                 

Gene name
fraH
Definition
(GenBank) heterocyst to vegetative cell connection protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: FHA DZR zinc_ribbon_2 Yop-YscD_cpl zf-ribbon_3 DZR_2 zinc-ribbons_6 zinc-ribbon_6 PMI_typeI
Other DBs
NCBI-ProteinID: BAA10665
CyanoBase: slr0298
CYORF: slr0298
UniProt: Q55902
Position
3009463..3010095
AA seq 210 aa
MAVCPTCNHTNPEGAIQCEACFTPLPTLMPCPHCGSSVQSDATFCGNCGQTIDPQQLVVS
APEEEEVPIPIAVAPESAEPIPAIPEVSSTPAPFPVGTQLQSQGASLVHVQTQTTLEIPA
GLTVIHLGKPNDKVPPDIDVSGFANSDVVSRVHADIRLEGNEYFLEDVGSANGTYVNHTA
LLPGNRHLLRPGDRLALGKGDLVTFIFQLH
NT seq 633 nt   +upstreamnt  +downstreamnt
atggctgtctgtcccacctgtaatcacaccaatccagaaggggccatccagtgtgaggcc
tgctttacccccctgcccactctgatgccttgtccccactgtggcagctccgtgcaaagt
gatgctactttttgcggcaactgtggacagaccattgatccccaacaattagtagtaagt
gctccggaggaagaagaggtccccatcccgatcgccgtagctccagaaagtgctgaaccc
attccggccattcccgaagtttcctccacaccggccccatttcccgtgggcacccaactc
caatcccagggagcttcccttgtccatgtgcagacccaaaccacgttggaaattcctgcc
ggcctaacggtaatccacctaggaaaacccaacgataaggtaccaccagacatcgatgta
tcgggttttgccaattccgatgtggtgtctagggtccatgccgatatccgtctggaaggc
aatgagtatttcttggaagatgtgggcagtgccaatggcacctacgttaaccacacggcc
ctcctcccaggcaaccgtcatttactgcgtcccggcgatcgccttgctttgggcaaaggg
gatttggtcacatttatatttcagttgcattag

DBGET integrated database retrieval system