KEGG   Synechocystis sp. PCC 6803: slr0329Help
Entry
slr0329           CDS       T00004                                 

Gene name
xylR
Definition
(GenBank) xylose repressor
  KO
K00845  glucokinase [EC:2.7.1.2]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00010  Glycolysis / Gluconeogenesis
syn00052  Galactose metabolism
syn00500  Starch and sucrose metabolism
syn00520  Amino sugar and nucleotide sugar metabolism
syn00521  Streptomycin biosynthesis
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
syn01120  Microbial metabolism in diverse environments
syn01130  Biosynthesis of antibiotics
syn01200  Carbon metabolism
Brite
KEGG Orthology (KO) [BR:syn00001]
 Metabolism
  Carbohydrate metabolism
   00010 Glycolysis / Gluconeogenesis
    slr0329 (xylR)
   00052 Galactose metabolism
    slr0329 (xylR)
   00500 Starch and sucrose metabolism
    slr0329 (xylR)
   00520 Amino sugar and nucleotide sugar metabolism
    slr0329 (xylR)
  Biosynthesis of other secondary metabolites
   00521 Streptomycin biosynthesis
    slr0329 (xylR)
   00524 Neomycin, kanamycin and gentamicin biosynthesis
    slr0329 (xylR)
Enzymes [BR:syn01000]
 2. Transferases
  2.7  Transferring phosphorus-containing groups
   2.7.1  Phosphotransferases with an alcohol group as acceptor
    2.7.1.2  glucokinase
     slr0329 (xylR)
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: ROK
Motif
Other DBs
NCBI-ProteinID: BAA10031
CyanoBase: slr0329
CYORF: slr0329
UniProt: Q55536
Position
2283794..2284777
Genome map
AA seq 327 aa AA seqDB search
MLVWLPWGVELARFSQFSLNGMSSPSSIHREVIGIDIGGSSIKFGRFLSNGDCTESLVLP
TPQPALPKAVYAQLAHGIDLLKNSACVAIGVGMPGPADAAGRVAQLAINLPQWHDIPLAD
WLEDHGQLPTVLENDANCAGLGEAWLGAGRDYRNFILLTLGTGVGGAVFLNGKLFTGPQG
AGGELGLISIETEGYPCNSGNRGSLEQHASAQTLRREMNLTGLELAQLAAKGDAEAIAYW
EKFGQRLGMGIANLVYVLTPEAVIIGGGLSASSSYFFPSMASEIEERVLLPSRRGLKILV
AQLGNRAGMIGAARLAWQKLVYRTDGP
NT seq 984 nt NT seq  +upstreamnt  +downstreamnt
gtgctggtatggctcccctggggggtagaattagcaagattttcccaattttcccttaat
ggcatgagttctccctcttccatacatcgtgaagtcatcggcattgacattggtggttct
tccattaagtttggccggttcctgagcaatggagattgcaccgagtccttggttttgccc
accccccaaccggctttacccaaggcagtttatgctcagttggcccatggtattgacctg
ttgaaaaattcagcttgtgtggcgatcggtgttgggatgccgggaccagcggacgcagca
ggacgggtggcccagttggcaattaatttgccccagtggcacgacattcctttggcggat
tggttggaagaccatggacagttgccgacggtattggagaatgatgccaattgtgctggc
ttgggggaagcttggctcggagcgggcagggattatcgtaattttattttgcttaccctg
ggcacgggggtggggggggcggtgtttttaaatggcaaattgtttacggggccccaagga
gccgggggggaattgggactaatttccattgaaacggaaggctatccttgcaatagcggc
aatcggggttctttggagcaacatgcttctgcccaaaccctacggcgggaaatgaatttg
accggcctggaattggcccaattggccgccaagggggatgcggaggcgatcgcctactgg
gaaaagttcggccagcggttgggcatgggcattgcgaacttggtctatgtgttgacccca
gaggcagtaattattgggggagggctaagcgccagctccagttacttttttccctccatg
gcatcggaaattgaggaaagggtgctattaccttcccgtcggggattaaaaattttggtg
gcccaactgggtaaccgagctggcatgatcggtgcggcccgcctagcctggcaaaagttg
gtttatcgcaccgatggcccttga

DBGET integrated database retrieval system