KEGG   Synechocystis sp. PCC 6803: slr0402Help
Entry
slr0402           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
  KO
K02428  XTP/dITP diphosphohydrolase [EC:3.6.1.66]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00230  Purine metabolism
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09104 Nucleotide metabolism
   00230 Purine metabolism
    slr0402
Enzymes [BR:syn01000]
 3. Hydrolases
  3.6  Acting on acid anhydrides
   3.6.1  In phosphorus-containing anhydrides
    3.6.1.66  XTP/dITP diphosphatase
     slr0402
BRITE hierarchy
SSDB OrthologParalogGene clusterGFIT
Motif
Pfam: Ham1p_like
Motif
Other DBs
NCBI-ProteinID: BAA18532
CyanoBase: slr0402
CYORF: slr0402
UniProt: P74432
Position
2151606..2152190
Genome map
AA seq 194 aa AA seqDB search
MPTLIVATGNPGKLAEMQTYLEPLGCQLTLKPTEIEVEETGSTFYENACLKASQVAKAVN
QWAIADDSGLAVDALDGAPGLYSARYGNTDRERIAKLLQALEGVSQRQAQFICVVSIAAP
DGSIQLSTKGICSGEITHSPRGDQGFGYDPIFWLPEHKKTFAEMTKVEKQKVSHRGKAFN
KLIHQWPGLKFDSF
NT seq 585 nt NT seq  +upstreamnt  +downstreamnt
atgcctactttaattgtcgccacgggtaaccccggtaaattagccgagatgcaaacttac
ttagagccccttggttgtcaattaacccttaagccaacggaaattgaggtggaggaaacc
ggcagtacattctatgaaaatgcttgcttaaaagcttcccaggtagcaaaggccgtgaat
caatgggcgatcgccgatgattctggtttggcagtggatgctttggatggggcaccgggt
ttatattccgcccgttatggcaacaccgacagggaaagaattgccaaattgctccaggct
ctagaaggggtaagccaaagacaagctcaattcatttgcgtggtgtcgatcgccgccccc
gatggcagtattcaactgagtactaaaggcatctgttcaggggaaattacccatagccca
agaggcgatcagggttttggctatgacccaattttttggctcccggagcacaaaaaaacc
tttgcagaaatgacaaaggtagaaaaacagaaagtgagccaccggggaaaagcgtttaac
aaactcatccaccagtggcctgggttgaaatttgacagcttttga

DBGET integrated database retrieval system