KEGG   Synechocystis sp. PCC 6803: slr0498
Entry
slr0498           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Ion_trans_2 YqhR
Other DBs
NCBI-ProteinID: BAA10569
CyanoBase: slr0498
CYORF: slr0498
UniProt: Q55815
Position
2904531..2905235
AA seq 234 aa
MFGKYRQKNLDNWHYRNLFWSIVLLLFFTMFVKTRMGGTITSILFTVTILVMVKNMAISS
LWKTFLRGLVAIALGCDLLTLLISNPTISQRLFTWADIVYAVFFGAAVITISQQLNKVQK
VDQNALLGAISVYLLIGVFWFLLYRISYIISPTNFNELQSDGINNFILLYFSFTTLTTLG
YGDITPTDSIAMGLSNMEAIVGQMYSVIFVARLVSLYTTDLNCHSQIREEQESD
NT seq 705 nt   +upstreamnt  +downstreamnt
atgtttggcaaatatcgacagaaaaatcttgataactggcattaccgcaatctgttttgg
tcaattgttttattactattttttaccatgtttgtgaaaacgagaatggggggaactatt
acttccatcttgttcacggtgactattttggtaatggtaaaaaatatggccatcagctct
ctttggaaaacttttctacggggactagtggcgatcgccttgggctgtgatttattaact
ttgttgattagtaatcccaccatttcccaaagactctttacttgggcggatatagtctat
gcggtgttcttcggggcggcagtgattaccattagccaacaattgaataaggtccagaaa
gtagaccaaaatgctttattaggagctatcagtgtctatttactgattggagtcttttgg
tttttactctaccggatatcctatattatttcccccactaattttaacgaattacaaagt
gatgggattaataatttcatcttgctctattttagctttacgaccttgaccaccctgggc
tacggtgacataactcctacggattccattgccatgggattgtccaacatggaagccatt
gtcggtcaaatgtactcggttatttttgttgctcgcctggttagtctttacacgactgac
ctcaattgccacagtcagatccgggaagaacaggaatctgattag

DBGET integrated database retrieval system