KEGG   Synechocystis sp. PCC 6803: slr0506
Entry
slr0506           CDS       T00004                                 

Gene name
pcr
Definition
(GenBank) protochlorophyllide oxido-reductase
  KO
K00218  protochlorophyllide reductase [EC:1.3.1.33]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00860  Porphyrin and chlorophyll metabolism
syn01100  Metabolic pathways
syn01110  Biosynthesis of secondary metabolites
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00860 Porphyrin and chlorophyll metabolism
    slr0506 (pcr)
Enzymes [BR:syn01000]
 1. Oxidoreductases
  1.3  Acting on the CH-CH group of donors
   1.3.1  With NAD+ or NADP+ as acceptor
    1.3.1.33  protochlorophyllide reductase
     slr0506 (pcr)
SSDB
Motif
Pfam: adh_short adh_short_C2 KR Epimerase
Other DBs
NCBI-ProteinID: BAA10580
CyanoBase: slr0506
CYORF: slr0506
UniProt: Q59987
Structure
PDB: 
6R48

Position
2914828..2915796
AA seq 322 aa
MEQPMKPTVIITGASSGVGLYGAKALIDKGWHVIMACRNLDKTQKVADELGFPKDSYTII
KLDLGYLDSVRRFVAQFRELGRPLKALVCNAAVYFPLLDEPLWSADDYELSVATNHLGHF
LLCNLLLEDLKACPDADKRLIILGTVTANSKELGGKIPIPAPPDLGNFEGFEAGFKKPIA
MINNKKFKSGKAYKDSKLCNMLTTRELHRRFHQETGIVFNSLYPGCVADTPLFRNHYSLF
RTIFPWFQKNVTKGYVSQELAGERVAMVVADDKFKDSGVHWSWGNRQQAGREAFVQELSE
QGSDAQKAQRMWDLSEKLVGLV
NT seq 969 nt   +upstreamnt  +downstreamnt
atggaacaaccgatgaaacccacggtgatcatcaccggagcctcctccggggtgggatta
tacggagctaaagctttaattgacaaaggttggcacgtgattatggcctgccgcaatttg
gataaaacccagaaagtagccgatgaattgggttttcccaaggattcctacaccatcatc
aaattggatttgggctatctggacagtgtgcgccgctttgtcgcccagtttcgggaattg
ggtcgtcccctcaaagctctggtttgtaatgcggcggtttattttcctttgctggacgaa
cccctctggtcagcggatgactatgaactttctgtggcgaccaaccacctggggcacttt
ttgctttgcaatctgttgttggaagatttaaaagcctgtcccgatgcagataagcgttta
atcattttgggcactgttacggccaacagcaaagaactagggggtaaaattcccatcccc
gccccgccggatttgggcaactttgaagggtttgaagcgggctttaagaaacccattgcc
atgattaataacaaaaaattcaaatcgggcaaagcgtataaagatagtaagctctgcaat
atgctcaccaccagggagttgcaccgtcgcttccaccaagaaacgggcatcgtttttaat
tctctctatccgggctgtgtagccgatactcccctattccgcaatcactattccttgttc
cgcaccatttttccctggttccagaaaaacgttaccaaaggctatgtcagccaagaattg
gcaggggaacgggtggccatggtggtggccgatgacaaatttaaggattctggggtgcat
tggagctggggcaaccgtcaacaagcgggccgggaagcctttgtgcaggaactttcggaa
cagggaagcgatgcccaaaaagctcagcgcatgtgggatctaagcgaaaagttagtgggt
ctggtttag

DBGET integrated database retrieval system