KEGG   Synechocystis sp. PCC 6803: slr0510
Entry
slr0510           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: MS_channel cNMP_binding DUF2649
Other DBs
NCBI-ProteinID: BAA10585
CyanoBase: slr0510
CYORF: slr0510
UniProt: Q55830
Position
2919706..2921223
AA seq 505 aa
MIAQINPPPQGPGPQAIANVLEQWHFLNIWLFETLNTPIFKLGTESITLWWIIQACFLLL
LVGVFAKATKQFLKKFLLLKLRFSEGNREVIGTLTSLGVAVLGFIVVLQAMGLELASFAV
IMGGLGIGIGFGLQELTRNLVSGLTIFGENKLKVGDLIEFNNHIGYIKEISIRSTIIRTF
RGSDLVVPNTDLTSNLVVNWNYENCSGRLEVPVSVEYGSDLVLVTEVLLESAAMEKNIVS
EPAPKAVFLGFGDNSLNFELWVWTERIDQRFLIFSSLNHIIQYNCRRRGINMPFPQRDIW
LRNPESICLAVSDQDNNATVPGKEVGESPTLTQLLKKNFCFQKLNDLEIRNVIEMGKRWH
LQPGEILIKQNQYHSYFCIVLTGAIDAIYENEKISNRIFTFKQGEFFGELPLMLEIPYPT
TMIAAEDSTLFLIGKDCFHILLANHPQLSNLVAEELGKRQDALQGYEQKLKEMGLLEEAD
LKNPVEWIRQRINKIFGVSQESAYR
NT seq 1518 nt   +upstreamnt  +downstreamnt
gtgattgcacaaattaatccaccaccacaaggaccagggccccaggcgatcgccaatgtg
cttgaacaatggcatttcctgaacatttggctgtttgaaacactgaatactcccatcttc
aaattgggcactgaaagcatcactttatggtggattattcaagcctgttttctccttttg
ctggtaggagtattcgccaaagctactaaacaattcctaaaaaagttcctactgctcaaa
cttagatttagtgaaggtaaccgagaagtaattggtacattaactagtttgggggtggcc
gtattaggctttatcgttgtattgcaagccatgggcttggaactagctagctttgcagta
attatggggggactagggattggcattggttttggcttgcaggaattaactaggaattta
gtcagtggtttgacaattttcggcgaaaataaacttaaagttggtgacttaattgaattt
aataatcacattggttacatcaaggaaatttccattcgctctaccatcatccgtaccttt
agaggtagtgacctagtggtgcccaacacggatttaaccagcaatttagttgttaactgg
aattatgaaaattgtagtggccgcctggaagtaccagttagtgtggaatatggcagtgac
ctagttttggtcacggaagtgctattggaatccgccgccatggaaaaaaatattgtcagc
gagcccgcaccaaaagcagttttccttggatttggggacaattctcttaattttgaactc
tgggtttggactgaaagaattgaccaaagatttctcatctttagctcccttaatcacatc
attcaatataattgtcgtcgtcgaggaattaatatgccctttccccaaagggatatctgg
ttgagaaatccagaaagtatctgtctagcagttagtgatcaagacaacaacgctacagtc
cccgggaaagaagtaggtgaatcccctaccctcactcagctactgaagaaaaacttctgc
tttcaaaaactcaacgatcttgaaattagaaatgtgattgaaatgggtaaacgatggcat
ttacagccaggagaaattttaattaaacaaaaccaataccacagctatttttgtattgtg
ctaactggggcgatagatgcaatttatgaaaatgaaaaaattagcaaccgtatatttact
ttcaaacagggagaattctttggtgagttgccattaatgttagaaattccctatcccact
actatgatagcggccgaagattccactttatttttgattgggaaagattgttttcatata
ttgttagcaaaccatccccaactatcaaatcttgtcgcagaagaattgggtaagcgccag
gatgctctccagggctatgaacaaaaactgaaagaaatgggactactcgaagaggcagat
ctaaagaacccggtggaatggattcggcaaagaattaataagatttttggtgtcagtcaa
gaatctgcatatcgttaa

DBGET integrated database retrieval system