KEGG   Synechocystis sp. PCC 6803: slr0513
Entry
slr0513           CDS       T00004                                 

Definition
(GenBank) periplasmic iron-binding protein
  KO
K02012  iron(III) transport system substrate-binding protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    slr0513
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr0513
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Mineral and organic ion transporters
   Iron(III) transporter
    slr0513
SSDB
Motif
Pfam: SBP_bac_6 SBP_bac_8 SBP_bac_11 SBP_bac_1 TAT_signal
Other DBs
NCBI-ProteinID: BAA10591
CyanoBase: slr0513
CYORF: slr0513
UniProt: Q55835
Structure
PDB: 
2VOZ 2VP1

Position
2924779..2925819
AA seq 346 aa
MTTKISRRTFFVGGTALTALVVANLPRRASAQSRTINLYSSRHYNTDDALYDAFGEVNLI
EASAEELIERIQSEGANSPGDILFTVDAGMLWRAEQAGLFQPVRSGKLNERIPENLRHPD
GLWYGFTQRARVLYYSRDRVNPADLSTYEALADPQWRGKILVRPSSNVYNLSLTASRIAI
HGEPETRRWLQGLVGNFARQPEGNDTAQIRAIAAGIGDVAIANSYYYIRLQKSTDPADQE
VVEKVSLFFPNTGSGERGTHVNVSGAGVLKNAPNRDAAIAFLEYLASDDAQRYFAEGNNE
YPVIPGVPIDPVLAAHGQLKGDPLNVSNLGRYQPDSARLMNEVGWQ
NT seq 1041 nt   +upstreamnt  +downstreamnt
atgacaactaagatttcccggcggactttttttgtgggcggcaccgccctcactgcccta
gtggtagctaatttgccccggcgggcctctgcccagtcccgcacgatcaacctctattct
tcacggcattacaacaccgatgatgccctctacgatgcttttggcgaggttaacctcatt
gaggccagtgccgaagaactgattgagcgtatccaaagtgaaggggctaatagtccaggg
gatattttattcaccgtagatgccggtatgttatggcgggcggaacaggcgggacttttc
caaccggtgcgcagcggcaagctgaatgagcgcattcccgaaaatttgcgccaccctgat
gggctatggtatggcttcacccagagagcccgggtgttgtattacagtcgcgaccgggtc
aatccagcggatctctccacctacgaagccctggcggatccccaatggcgaggaaaaatt
ctggtgcgcccttccagtaatgtatataacctttccctaactgcttcccgcattgccatc
catggagagccagaaacccgccgctggttacaaggcttggtgggtaactttgcccggcaa
ccggagggtaatgacacggcacaaattcgtgctattgccgccggcatcggagatgtggcg
atcgccaatagctactactatatccgcctgcaaaagtccaccgatcccgccgatcaagaa
gtggtggaaaaagtcagccttttctttccaaacactggctccggagagcggggaacccat
gtcaatgtcagtggggctggggtgctgaaaaatgcccccaatcgagacgcggcgatcgcc
ttcctggaatatctagccagtgatgacgcccaacgttattttgctgagggcaacaatgag
tatccggtaattccaggggtacccattgatcctgtgctagccgcccatggccaactaaaa
ggagaccccctcaatgtttctaacttgggacgttaccaacccgattcagctcgtttaatg
aatgaagttggctggcagtaa

DBGET integrated database retrieval system