KEGG   Synechocystis sp. PCC 6803: slr0516
Entry
slr0516           CDS       T00004                                 

Definition
(GenBank) hypothetical protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: Pentapeptide Pentapeptide_4 Pentapeptide_3
Other DBs
NCBI-ProteinID: BAA10593
CyanoBase: slr0516
CYORF: slr0516
UniProt: Q55837
Position
2926783..2927283
AA seq 166 aa
MNNKKLSLTLPLVGILALTACNQPKEEIDPLSQLREKGECLDCNLAGADLREFNLENARL
NRSDLSGANLSGVNLRRALLDRANLTGANLSETDLTEAALTEANLAGADLSGANLERSFL
RDVDLTGANLKGANLAWANLTAANLTDVDLEEAEFWETTMPDGSRR
NT seq 501 nt   +upstreamnt  +downstreamnt
atgaataacaaaaaactcagcctaaccctgccattggtaggaatcctagctctgacggct
tgtaatcagcccaaggaagaaattgatcccctatcccagttgcgggagaaaggggaatgt
cttgattgcaatctagcgggggcagacctgcgggagtttaatttggaaaatgcccgcttg
aaccgttctgatttatcgggggcaaatttatcgggggtgaatttacggcgggcgttgttg
gaccgggccaacttgacaggggcaaatctgagtgaaacggatttaaccgaagcggcctta
actgaagccaatctggccggggcggatttgagcggcgctaatttggaacggagttttctg
cgggatgtggatttaactggagctaatctgaaaggagccaacctagcctgggccaattta
acggcggccaacttaaccgatgtcgatttggaggaggcggaattttgggaaacaaccatg
cccgatggttctcgtcgttaa

DBGET integrated database retrieval system