KEGG   Synechocystis sp. PCC 6803: slr0521
Entry
slr0521           CDS       T00004                                 

Definition
(GenBank) unknown protein
Organism
syn  Synechocystis sp. PCC 6803
SSDB
Motif
Pfam: EamA TMEM234 Mg_trans_NIPA TPT Nuc_sug_transp DUF1933
Other DBs
NCBI-ProteinID: BAA10600
CyanoBase: slr0521
CYORF: slr0521
UniProt: Q55844
Position
2933159..2934172
AA seq 337 aa
MAWPCLSVRLVHEGKYGLFTSKRRGSLTLLTGAKRLTLTEWKTIGLLLTMVTTQVLGDIW
LSRGMKVFGAVEDYSLAGLWTLFLYLLTSPWIVVGVITLLFALFLYFTATSRLDLSLVLP
LFSSSYILNALLAWLILGEEVSFYRWLATFMIASGVFIVCWSEHRHRSQLMGEKFSPTPA
PVVPVKSSRRSPLWLFPVGIALSRVWFGILILIFTDSAGDVLIARGMKQIGPVRLQSPLK
MVKLIGRILSHPSVLGGIGCQTISFVTFISLLSWTDISLIRPAGALGYVMSLLGAKFLLK
ETIPLARWLGIGVITAGVALIALDEVNLVDQILLFFL
NT seq 1014 nt   +upstreamnt  +downstreamnt
atggcctggccatgtttatcagttaggttagtccatgaaggcaagtatggcctattcaca
tctaaacgaagaggatcattaactttgctcaccggagctaaacgcttaacgttaacggag
tggaaaaccattggcctcctgctgaccatggtcactacccaggtgttgggggatatttgg
ctcagccggggcatgaaagtgttcggcgcagtggaagattatagtcttgcaggtttgtgg
acattgtttctctatctgctcacttccccctggattgtggtgggggtaatcacgttactg
tttgccctgtttctctatttcaccgctacatcccggctggatttaagtttagttctgccc
ctattttcttccagctacattctcaatgccctactggcatggctaatactgggggaagaa
gtttccttttaccgttggctggccacttttatgatcgccagtggagtatttattgtctgt
tggtcagaacatcgccaccgttcccaactaatgggggaaaagtttagcccgaccccagcc
ccggtcgtaccagttaagtcttcccggcgatcgccattgtggttatttcctgtgggcatt
gccctttctcgggtttggtttggcattttgattttaattttcaccgattccgctggggac
gtactcattgcccggggcatgaaacaaattggccctgtgaggttacaatcgcccctgaaa
atggtcaagttaattggtcgtattctttcccatccctcagtgttagggggcattggttgc
caaaccatcagttttgttacttttatttccctgctcagttggaccgatattagcctgatc
cgaccagcgggggcattgggttacgtcatgagcctattgggggccaaatttttgctgaaa
gaaaccattcccctggctcggtggctgggcatcggcgtgattaccgctggggtagccctt
atcgccctcgacgaagttaatttggtggatcaaattttgctatttttcctgtag

DBGET integrated database retrieval system