KEGG   Synechocystis sp. PCC 6803: slr0523
Entry
slr0523           CDS       T00004                                 

Definition
(GenBank) dethiobiotin synthetase; BioD
  KO
K01935  dethiobiotin synthetase [EC:6.3.3.3]
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn00780  Biotin metabolism
syn01100  Metabolic pathways
Brite
KEGG Orthology (KO) [BR:syn00001]
 09100 Metabolism
  09108 Metabolism of cofactors and vitamins
   00780 Biotin metabolism
    slr0523
Enzymes [BR:syn01000]
 6. Ligases
  6.3  Forming carbon-nitrogen bonds
   6.3.3  Cyclo-ligases
    6.3.3.3  dethiobiotin synthase
     slr0523
SSDB
Motif
Pfam: AAA_26 CbiA DUF1611
Other DBs
NCBI-ProteinID: BAA10605
CyanoBase: slr0523
CYORF: slr0523
UniProt: Q55849
Position
2939802..2940515
AA seq 237 aa
MSNFSRAVDQKTLLVAGCDTGVGKTVTTSALAAYWWKCGKDQSFGLMKLMQTGLGDDELY
QQLFGHLTRWDVVTPLKFATPLAPPLAADQEGKTIDLGVVWQTLQTMQQNHDHVLVEALG
SLGSPVTHELTVADIAALWRLETILVVPVQLGAMGQAIAQVALARQTKVKLKGLVLSCAS
PEAEGKVEDWATPAMLESFTHLPVLGIVPYLTESERENLSRLAEITARFGLEKLAYF
NT seq 714 nt   +upstreamnt  +downstreamnt
atgtcgaatttttcccgagccgttgaccaaaaaactttattagttgcgggttgcgacaca
ggggtggggaaaacggtaactacttcggcgttggcggcctactggtggaagtgtggcaaa
gatcagtctttcggactaatgaagttgatgcagactggtctgggggatgacgagctttac
caacaattattcggccatctgacccgctgggatgtggtgacgccgctgaaatttgctacg
cccctagctcctcctttggccgctgaccaagaaggaaaaaccattgatttgggagtagtc
tggcagactttgcagacaatgcaacaaaaccatgaccatgtactggtggaagccctgggt
agtttgggttcccccgttacccacgaactgacagtggcggatattgccgccctttggcgt
ttggaaactattttggtggtgccggtgcaactgggggccatgggccaggcgatcgcccag
gtggccttggccagacaaactaaggtcaaactgaagggcttagtgctcagttgtgctagc
ccggaggcggagggcaaggtggaagactgggccactccagctatgttggaatcctttacc
catttgccggttttggggattgtgccctacctaaccgagtcggagcgggaaaatttatct
cgtttagcggagattacggcccgatttggcctggaaaaattagcctatttttag

DBGET integrated database retrieval system