KEGG   Synechocystis sp. PCC 6803: slr0529
Entry
slr0529           CDS       T00004                                 
Name
(GenBank) unknown protein
  KO
K10232  alpha-glucoside transport system substrate-binding protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    slr0529
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr0529
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Alpha-glucoside transporter
    slr0529
SSDB
Motif
Pfam: SBP_bac_1 SBP_bac_8
Other DBs
NCBI-ProteinID: BAA10817
CyanoBase: slr0529
UniProt: Q55471
Position
3188483..3189748
AA seq 421 aa
MKFFKITTLIISLIVLTSCQGPGVNGDEDRKQVTILGVMIGEQQEKIEQALAPFTEATGI
EVVYEGVDTFATTLPIRVDSGRAPDLAMFPQPGLMADFAREGKLVPLGEILTPEEMTEAY
DQAWLDLAAVDGTVYGVWYRASVKSLVWFNPQEFAANGYEVPGTWEEMMALSQRLIDKGK
TPWCLGIESGNATGWVGTDWVEDIMLRTASPATYDQWVAHDIPFNDRRVENALDIFGEIT
QNEKMIYGGKVGALSTPFGDSILGLFTDPPHCYLHRQGNFIAAFLPADVDDDQVDIFPLP
PIEEEYGLPILVAGDIFAMFNDTPEARQLMAYLASSRPHEVAATLGAYISPHKNIDLNLY
PDRLTRKQAEILNKAEVIRFDASDMMPGAVGTGTFWSGMVDYIGGADGTQVLNTIERSWP
R
NT seq 1266 nt   +upstreamnt  +downstreamnt
atgaaattttttaaaatcactaccctgataattagcctgattgttctcactagttgccag
ggcccaggggttaatggggacgaagacagaaaacaggtgaccatccttggggtaatgatt
ggggaacaacaggaaaaaattgaacaagccctagcgccctttaccgaagccaccggcatt
gaagtggtttacgaaggcgttgatacctttgccaccaccttacccattcgggtcgactcc
ggtcgagctcccgatttagccatgtttccccagccgggattgatggcggattttgccagg
gaaggaaaattagttcccctgggggaaattctcaccccggaggaaatgacagaggcctat
gaccaggcttggttggatttagctgcggtggatggcaccgtttacggcgtttggtatcga
gcctcggtcaaaagtctagtttggtttaatccccaagagtttgctgctaatggttatgaa
gttcctggcacttgggaagaaatgatggcccttagtcaacggctgattgataaaggcaaa
actccctggtgtctgggcatcgaaagtggcaatgctacgggctgggtgggcaccgattgg
gtcgaagatattatgttacgcactgctagtccggcaacctatgaccagtgggtagcccat
gatattcccttcaacgatcgccgggtggaaaatgccctggatatttttggcgaaattacc
cagaacgaaaaaatgatttacggcgggaaggtgggggctttgagcacgccttttggagac
tctattttaggattatttaccgatcccccccattgttatctacaccgccaagggaatttc
attgccgcttttttgccggcggatgtggacgatgaccaggttgatattttccctttgccc
cccattgaagaagagtatggcttacccatcctggtggcaggggatatttttgccatgttt
aacgatacgccggaagctaggcagttgatggcatatttggcgagctcccggccccatgaa
gtagccgccactttaggagcttatatttctccccacaaaaacattgacctgaatctctat
cccgatcgcctgacccgtaaacaggcggaaattttgaacaaggcggaggtgattcgtttt
gatgcgtccgatatgatgccgggagcggtgggcacggggacgttttggtctggcatggtg
gactacatcggcggcgccgacggtactcaagttttaaacaccattgaaagaagttggccc
cgttag

DBGET integrated database retrieval system