KEGG   Synechocystis sp. PCC 6803: slr0531
Entry
slr0531           CDS       T00004                                 
Name
(GenBank) membrane bound sugar transport protein
  KO
K10234  alpha-glucoside transport system permease protein
Organism
syn  Synechocystis sp. PCC 6803
Pathway
syn02010  ABC transporters
Brite
KEGG Orthology (KO) [BR:syn00001]
 09130 Environmental Information Processing
  09131 Membrane transport
   02010 ABC transporters
    slr0531
 09180 Brite Hierarchies
  09183 Protein families: signaling and cellular processes
   02000 Transporters [BR:syn02000]
    slr0531
Transporters [BR:syn02000]
 ABC transporters, prokaryotic type
  Saccharide, polyol, and lipid transporters
   Alpha-glucoside transporter
    slr0531
SSDB
Motif
Pfam: BPD_transp_1
Other DBs
NCBI-ProteinID: BAA10819
CyanoBase: slr0531
UniProt: Q55473
Position
3190768..3191664
AA seq 298 aa
MTKAVNKSNRTNNTNRKTEFWQKLPIHIAILTIAFIWTLPSLGLFISSLRPRGDMLSTGW
WTVFWHPLEITQFYLGNYGDVLRSSGMGEAFLNSLTIAVPATVIPIAIATFAAYAFAWMT
FPGRQLLFILVVCLLVVPLQTTLIPVLRVYAQLGLAGTFLGVWLAHTAYGLPLGIYLLRN
YIGALPKDLIEAAAVDGASHLKIFTKLIVPLSMPAIASFAVFQFLWVWNDLLVALVYLGG
TADVAPVTIQLSNLVGSRGQDWYLLTAGAFISMIVPLMVFFGLQRYFVRGILAGSVKS
NT seq 897 nt   +upstreamnt  +downstreamnt
atgaccaaagccgttaataaatctaataggactaataacaccaatagaaaaacagaattt
tggcaaaaacttcccattcacatagcaattctcaccattgccttcatttggacattgcct
agtttaggtctatttattagctccctacggccccggggggacatgctcagcactggttgg
tggacagtattttggcaccccctagaaattacccagttttatctgggcaactatggggac
gttttacgctcctccggcatgggggaagcttttttaaacagtttgaccattgctgtgcct
gccacggtgattcccattgccattgccacctttgccgcttacgcctttgcttggatgacc
tttccgggacgacaattattatttattttggtggtctgcctactggtggtgcctttacaa
accactcttattcctgttttgagggtttacgcccaattgggcctagcgggcactttcctt
ggggtttggttagcccacactgcctatggtctgcccctgggtatttacctgttacgcaac
tacattggcgctcttcccaaagacctaattgaagcggcggcggtggatggtgcttcccat
ttaaaaatttttaccaagttaattgtgccactctccatgccggcgatcgcctcctttgct
gtatttcaatttctctgggtatggaatgatttattggtcgccctggtttacctggggggc
accgccgatgttgcccctgttaccatccaactgagtaatttagtcggctcccggggacag
gattggtacttattaaccgctggagctttcatcagcatgattgtgcccctaatggttttc
tttggtttgcagcggtactttgtgcgaggcattctggcaggatcagttaaatcctaa

DBGET integrated database retrieval system